SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr1P03300_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr1P03300_001
Domain Number 1 Region: 38-188
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.84e-32
Family Ankyrin repeat 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr1P03300_001
Sequence length 210
Comment pep:novel chromosome:MA1:1:2696990:2701522:1 gene:GSMUA_Achr1G03300_001 transcript:GSMUA_Achr1T03300_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence
MAVPGRRNGVMDEEDDEDDVLFDDGDALADLDLDSDVPPHLRALVEAAESGNVDALRSAL
DNHTGSIDEPVEDGDTVLHLSCLYGYFPCVQLLLERGASLESKDEEGAIPLHDACAGGFT
EIVQCMLNSAGSPDFVMQLLSATDIEGDTPLHHAARGEHLDVVKLLLAAGASPKKTNIYG
KIPAELADQETEVRSILIAATASADEVSCQ
Download sequence
Identical sequences M0RWN8
GSMUA_Achr1P03300_001 XP_009390211.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]