SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr2P16170_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr2P16170_001
Domain Number 1 Region: 511-633
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.31e-19
Family Anti-sigma factor antagonist SpoIIaa 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr2P16170_001
Sequence length 684
Comment pep:novel chromosome:MA1:2:17180513:17191378:1 gene:GSMUA_Achr2G16170_001 transcript:GSMUA_Achr2T16170_001 description:"Sulfate transporter 4.1, chloroplastic"
Sequence
METHSSSASGGGVARVASSSSLGGGGGRAVKVIPLQDPAPPSPYLQSAALASRWAEKVRG
MSALAWLELLLPCSRWIRTYRWRESLQADLMAGITVGVMLVPQAMSYAKLAGLQPIYGLY
GGFVPVLVYAVFGSSRQLAVGPVALTSLLVSNVLSPIVDSSDELYTELAILLALMVGILE
CLMGLFRLGWIIRFVSHSVISGFTTASAIVIALSQSKYFLGYSIVRSSKIIPLVKSIIAG
ADDFSWPPFVMGSIFLTVLLTMKHLGKSNKNLRGVRAAGPLTAVVLGTIFVKIFHPSSIS
VVGEIPQGLPKFSIPRGFEHVKSLISTAFLITGVAILESVGIAKALAAKNGYELDSNQEL
FGLGVANICGSFFSSYPSTGSFSRSAVNNESGARTGLSGIIMGIIMACALLFLTPLFTEI
PQCALAAIVISAVMGLVDYEEAIFLWCLDKKDFLLWTITFITTLFFGIEIGVLIGVGVSL
AFVIHESANPHIAVLGRLPGTTVYRNILQYPEAYTYNGIVIIRIDSPIYFANISYIKDRL
REYELDLDGSTKRGPDVGRIYFVIIEMSPVTYIDSSAVQALKDLNQEYRSRGIQIAIANP
NREVHLLLSRSNLIEMIGKEYFFVRVHDALQVCLQHVQSLNPSSPKVSSGHTPPRTRSFL
QSIWKQGSDGSTPEVEPLLPRNEV
Download sequence
Identical sequences M0S8F8
XP_009388632.1.42102 GSMUA_Achr2P16170_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]