SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P02760_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P02760_001
Domain Number 1 Region: 330-442
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000023
Family Ankyrin repeat 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P02760_001
Sequence length 623
Comment pep:novel chromosome:MA1:3:1796658:1802160:-1 gene:GSMUA_Achr3G02760_001 transcript:GSMUA_Achr3T02760_001 description:"F-box/ankyrin repeat protein SKIP35"
Sequence
MDLVHLVKDNQAEDVLCSEMEIDENDVLSCMNDHHNVGSEKGEGSTVVFSREAPLLTKDA
LISKDYGCGSKKIRSRASVLMEESEVRSKDKWKQEKKLSRQDRIELGRLFQRVVSSQDSE
LAENLIQLADPQTLNDMLCIALDSIWFLTNRQELNIITGLIKKIVANGANEFTRAALRTS
FLASCVSACQSRTMSLADTVGIMAQRLHERLQECHSDEVLKAEAGAKVQKFTEWALKCIG
IHCRCQENKGRRNHSTIVEVQLQLSAFKTFLDIAGNHLSGKDFTEAFDAACFPLTLFSSS
FEPGWASGTSATAIQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAQRNSLDVD
VDLALGFASHYSKIGTMECLVEEGNAGAFLGPLMRAAERGCMQVVEWFVTRGCKDMELCL
ALTAAASSSQVGIAAYLLPHIPQHVLAALSIEILKAAGERSSGSLDGVVFLLRSDFLGDP
AATYAVADSMARSSDESVASDLRAFLKEHWSEAAFAEGLRFGQDHFVNIMRIFRRGSSPI
HLKDLPQPLVTAIAYLPLYRECLEAGGQLLPQKLRGQLVEAAHRVSGRPVSKNSQTRELM
AILEHHLPTFFLQAPTVSRAAYR
Download sequence
Identical sequences M0SB94
GSMUA_Achr3P02760_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]