SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr3P25880_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr3P25880_001
Domain Number 1 Region: 257-356
Classification Level Classification E-value
Superfamily Ankyrin repeat 2.8e-16
Family Ankyrin repeat 0.0017
Further Details:      
 
Domain Number 2 Region: 33-174
Classification Level Classification E-value
Superfamily POZ domain 0.00000000000408
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr3P25880_001
Sequence length 568
Comment pep:novel chromosome:MA1:3:25921646:25927005:1 gene:GSMUA_Achr3G25880_001 transcript:GSMUA_Achr3T25880_001 description:"Putative Regulatory protein NPR1"
Sequence
MEAAGTFCESRITSGGSLCYAAPVAAEVAALSRLSEHLGSLLRTPGLAFCSDARITVRSA
GGDPPHEVPVHRCVLSARSPFFRDKFAAGAVALELGEVVAGFEVGCEALEVVLQYVYTGR
LEELPRGVAECVDETCRRHEACWPAVHFMLRVLHAASTFEINELVSLFQRRLLDILEKVA
MNEVLSILFVANLNYKLCQRLFMKAIDMVVNSDISYITLQKKLPSNVVKQIKQSRSNLGL
DGQENFKFPDKHVKSIYGALDSDDIELVKLLLEEGHTTLNDAKGLHYAVASCDSKITKEL
LDLGLADVNSRDHQNYTVLHVAAMRKDPEIIMSLLTMEARPLEITSDGRTALQISKRLTR
STDYYRSTEQGKPSPRERLCIEMLQRAEMIETFTEVTSVPVEMTSDNLHEKLLYLESRVW
LAERLFPTEAKAAMNNANVDGTLKVHSSCLTHLCAGNKRSAEDVVKASFRMTEENLSRME
ALTKTVQLGMHFFPRCSKVIDKILGDDLSELSIVEHINTEERKNRYTEILEEINNAFTQD
KTAFDRSVSCSTSSSKSARAVRSKAARK
Download sequence
Identical sequences M0SHV4
XP_009392990.1.42102 GSMUA_Achr3P25880_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]