SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P03670_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P03670_001
Domain Number 1 Region: 165-229
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.31e-18
Family B3 DNA binding domain 0.0000972
Further Details:      
 
Domain Number 2 Region: 51-107
Classification Level Classification E-value
Superfamily DNA-binding domain 1.11e-16
Family GCC-box binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P03670_001
Sequence length 294
Comment pep:novel chromosome:MA1:4:2928262:2929308:1 gene:GSMUA_Achr4G03670_001 transcript:GSMUA_Achr4T03670_001 description:"AP2/ERF and B3 domain-containing transcription factor RAV1"
Sequence
MATSSIEEACEETREWPPVASKSLQRVASGGSEVIDPEGCVEAEFRKLPSSKYKGVVSQP
NGRWGAQIYEKHQRIWLGTFNEEAQAARAYDVAVQRFRGRDAVTNFKPLNDADDEDAAEL
FFLDSHTKHEIVDMLRKRTYHNELQQSKRSIGADNKKGIAGGAASKGVLLSFEDGCGKEW
RFRYSYWNSSHSYVLTRGWSRFVKEKRLEAGDVVTFQRSTGTDKQLFIDAKARSGVQVLR
LFGVNIVRGPAAAIGEGGVDDNAVFCTTGKKNRDHITELVSSQGMFKKQRTEAL
Download sequence
Identical sequences M0SKT4
GSMUA_Achr4P03670_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]