SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P05110_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P05110_001
Domain Number 1 Region: 84-159
Classification Level Classification E-value
Superfamily Skp1 dimerisation domain-like 4.84e-33
Family Skp1 dimerisation domain-like 0.0000217
Further Details:      
 
Domain Number 2 Region: 3-63
Classification Level Classification E-value
Superfamily POZ domain 6.28e-23
Family BTB/POZ domain 0.00044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P05110_001
Sequence length 161
Comment pep:novel chromosome:MA1:4:3966735:3970626:1 gene:GSMUA_Achr4G05110_001 transcript:GSMUA_Achr4T05110_001 description:"SKP1-like protein 4"
Sequence
MAKMITLKSSDGEVFEVDEAVAMESQTIKHMIEDDCAENGIPLPNVTSKILAKVIEYCRK
HVDASAAAASKSSDDSSKLADDELKSWDAEFVKVDQATLFDLILAANYLNIKGLLDLTCQ
TVADMIKGKTPEEIRKTFNIKNDFTPEEEEEVRRENQWAFE
Download sequence
Identical sequences M0SL78
XP_009395385.1.42102 GSMUA_Achr4P05110_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]