SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P06710_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P06710_001
Domain Number 1 Region: 140-244
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.22e-31
Family B3 DNA binding domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 42-98
Classification Level Classification E-value
Superfamily DNA-binding domain 2.88e-16
Family GCC-box binding domain 0.0009
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P06710_001
Sequence length 350
Comment pep:novel chromosome:MA1:4:5028415:5029619:1 gene:GSMUA_Achr4G06710_001 transcript:GSMUA_Achr4T06710_001 description:"AP2/ERF and B3 domain-containing transcription repressor TEM1"
Sequence
MRKTGPVPSPDPKSLQRVGSGASDVIDPEVGVEAESRKLPSSHYKGVVPQPNGRWGAQIY
EKHQRVWLGTFNEEAEAACAYDVAVQRFRGRDAITNFKPLNDADNGDAAELSFLDSHSKA
EITAPRSAPVTGLLVGAQRQHLFDKAVTPSDVGKLNRLVIPKQHAEKHFPLQKTGAAAAA
GKGVMLNFEDAYGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKGLEAGDVITFHRSTDPEK
QLFIDSTARAGRGSAVAPTQRPPVQVVRLFGFNIVRNPAAPVGGDGVDGNAASCETGKRN
RDHMKSISSQRMIKRHCTEAFEENDSIRNFISFFLYCSVLLIQSVHMDCL
Download sequence
Identical sequences M0SLN8
GSMUA_Achr4P06710_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]