SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr4P32060_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr4P32060_001
Domain Number 1 Region: 279-381
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.04e-17
Family Ankyrin repeat 0.0015
Further Details:      
 
Domain Number 2 Region: 70-198
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000000251
Family BTB/POZ domain 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr4P32060_001
Sequence length 595
Comment pep:novel chromosome:MA1:4:28982816:28987433:-1 gene:GSMUA_Achr4G32060_001 transcript:GSMUA_Achr4T32060_001 description:"Putative Regulatory protein NPR1"
Sequence
MPNLTEPSSSISFASSSYLSNGSSAYHVPGGTAPSPSPPPAAPEGGTNLEVLSLSKLSTN
LERLLLDTEFDCTDAEIAVEGAPVGIHRCILAARSRFFRDLFSREGSGGNRQEGKPRYVM
NELVPGGRIGREAFMVFLSYLYTGKLRAAPQDVSICVDRFCAHDACRPAIGFAVELLYAS
SVFQIAELVSLLQRRLLNFVDKAMVEDVIPILQVASHSKLNQLLSHCVQRVARSDLDDIA
LEKELPQEVAEEIRLLRRESQPKESTATVDPMLEKRIKRIHRALDSDDVELVKLLLSESG
VTLDDAYALHYAAAYSDSKVVAELLDLGSANVNLKNDRGYTALHLAAMRREPAVIVSLLT
KGASALETTADGQNAVRICRRLTRAKDYFTRTEQGQESNKNKICIDILEREIMRNPLAAE
DSATSPLLADDLHMKLLYLENRVAFARLFFPAEAKLAMEIAHANTTSEFTGIAKSRSSSN
LRDVDLNETPVVQNKRLRSRVDALSKTVELGRRYFPHCSQVLDKFLEDDLPDVFYLQKGT
PDEQKVKKLRFCELKEDVRKAFSKDKAGSLLSGLSSSSSSSSPKSEEKHHTFARN
Download sequence
Identical sequences M0STW8
XP_009397343.1.42102 GSMUA_Achr4P32060_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]