SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P00320_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P00320_001
Domain Number 1 Region: 550-743
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000736
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 2 Region: 713-909
Classification Level Classification E-value
Superfamily Tropomyosin 0.0000262
Family Tropomyosin 0.0026
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr5P00320_001
Domain Number - Region: 435-543
Classification Level Classification E-value
Superfamily Tropomyosin 0.0196
Family Tropomyosin 0.0062
Further Details:      
 
Domain Number - Region: 97-294
Classification Level Classification E-value
Superfamily Tropomyosin 0.034
Family Tropomyosin 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P00320_001
Sequence length 1387
Comment pep:novel chromosome:MA1:5:232423:239043:-1 gene:GSMUA_Achr5G00320_001 transcript:GSMUA_Achr5T00320_001 description:"retrotransposon protein, putative, unclassified, expressed"
Sequence
MAEDLHPNEIEVKLSGEVGENEKESLTNGDTDLPSKEGNKEEESPSDGEYIKVEKEILVD
AEQSSHLLNLIMEVEENLIAVNHQSGNSEANVNFMETREKIKELKVQFETILAKFISSEA
EKALLKSKFELTNDKLDKMNKHHEELELGQKLMKNQISEAERKHTLQLESHQEALKATEM
KHKELVDIRESFTGLSAELESSRRRIKALEEELLSSVSELHKAEEISKSSSLQAELESRK
VLELEKMLEVAHVTAKETEAQISNLQEELKELYEKIAEKKQVEQELQSTSLELSKFQEKL
EISKSEAAQLEQNLVSKDAAMHKLIEELNLHKVSDEQLRTNVTELELRLQEKVKEREMFE
ACFKDQEVQISSLRNDLSNLAVEKATLDNIVTELNTKLLEKEELHTKFEAKLNVADQDFK
KTDSLLSQALSYKDDLEKKLELVEQLHHESRTVTEAATKRNIELEDLVHASNAAEEDLRS
QLKDSEMRLASTEKRIMELEQQINLAEIRYLDAQSEIKELNEKITELTASLKEVDEENAL
SRRRFEGYDDRVDQLESSLSKSFSRNVELENELNDLMKECAEHEEHATARHHHSLKLEDF
VQSSHSRAEDAEKRAAELELLLEAANYRMQELEQLLSITEAKHKDVEVESKQYSSKVSEL
LTELVAYQTQTQSLEAKLQAANEKERELTDILNIVTEERKKIEDLSINQGEKLYESENQI
QILQNELKYLREKVEGVQKDLDNSSVREKELLEKLRYAGEQLGHHVKIVEEVTSRNIELN
SLNESLVNDSELKLQEVEVSFKERESEAKELHGKLKSLEEQLAFYKEQAIEATESVSSLK
AELEAGAVKLVSLVNNVEELKQKVSEANLRGEQTISENELLALTNSKLREELEAQQHEVN
ELNELLKSIHAEKEATDEQLASHATIEKYKQREMQARELNEKLLALETQLRNHEEQASLS
AISATSQKGKLEEALCKIQDLDGHVQQLKAKSDQFRTENEGLARQNARFSEELAAYETKM
NELQVALNAAVTEKEDISVQLLASKKEMMDLVQLHNSDKEKLQSQITSAMEEHNMVSEMY
HKATKELESTIVQLEEKLSEKKAREDSLNSLTENLKAQLAEKSLMQSQIPELEQKLLLAE
KTYIQEIESMATAAAQKDAVLSAKLGEHTSVLQERDALDQQLREVLQELDLARRTIIEQK
ELGSVKESERQASMKQSLDALESKNQHTTLLEKQVEGLQQKLQEAEAHYREKVIEENTKL
ALVEVELNELRLKQSQTTEMEKKIAELENTLHLARTSAEEVKNETSQAEMQDAAIEVKSR
DLGLDTSTLSKRKSKKRSDRVHHDTNAATVSPNAQVTPERSGAMAFKFILGVALVSIFIG
VILGKRY
Download sequence
Identical sequences M0SUG1
GSMUA_Achr5P00320_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]