SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P13140_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P13140_001
Domain Number 1 Region: 63-130
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000000855
Family Ankyrin repeat 0.0042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P13140_001
Sequence length 529
Comment pep:novel chromosome:MA1:5:9367098:9370903:-1 gene:GSMUA_Achr5G13140_001 transcript:GSMUA_Achr5T13140_001 description:"ankyrin repeat domain containing protein, expressed"
Sequence
MAGTDLIKYAHSPAHRAVLARDYAGLKRVLAALPRLVDPSAIRTEAASVAEEEKADAISA
VIDRRDVPNRETPLHLAVRLGDAAAVEMLMAAGADWSLQNEQGWSALQEAICAGEENLAK
IIVRHYQPLAWAKWCRRLPRVVATMRRMRDFYMEITFHFESSVIPFISRIAPSDTYKIWK
RGSNLRADMTLAGFDGFRIQRSDQSILFLGDGSEDGKVPPGSLCMISHKDKEVMNALDGA
GTPATEAEVHQEVKAMSQTNIFRPGIDVTQAVLLPQLTWRRQERSEMVGPWKAKVYDMHN
VVVSVKSRRVPGAMTDEELFSACNDNETESEDFEDILTEEERKQLEKALKMESPEVIDQN
SKESEYRKGLRPVLWLSPDFPLRTEELLPLLDILANKVKAIRRLRDLLMTKLPPGAFPVK
VAIPVVPTIRVLVTFTKFEELQPLEEFSTPPTSPGNNSPQTQTSSSSWIQWIKAPYRQNY
SITSGPSSRVEDIQDPFVIPPDYSWTTPAAKRKKMQEKSKSKKGKGQNQ
Download sequence
Identical sequences M0SY43
GSMUA_Achr5P13140_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]