SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr5P21190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr5P21190_001
Domain Number 1 Region: 190-321
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-16
Family Ankyrin repeat 0.0026
Further Details:      
 
Domain Number 2 Region: 11-98
Classification Level Classification E-value
Superfamily E set domains 0.000000000000098
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 379-438
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000982
Family Motor proteins 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr5P21190_001
Sequence length 532
Comment pep:novel chromosome:MA1:5:23161613:23179945:-1 gene:GSMUA_Achr5G21190_001 transcript:GSMUA_Achr5T21190_001 description:"Calmodulin-binding transcription activator 5"
Sequence
MATSMGDHVFNITEISPGWSYSTEETKVVVVGHFCESKKHLMSSSIYCVVGEICVKAEMV
QPGIYRCKVSPQPPGLVNLYLTMDGHTPVSQVLSFDYRCSPNIQLDGQIFPSEDDRNKLK
WEDYQVQKRLAHLLFATSNNTSILSSRIPLKSLNEAKRFAMLTSSLIEKDWTNFLKLDST
NKFSSASTRENLLELVLRNKLQEWLLVKVAEGCETPGHDSQGHGVIHLCAILNYAWAVRL
YSLSGLSLDFRDIHGWTALHWAAYCGREKMVATLLSAGANPSLVTDPTSETRGGCIAADL
ASKQGYEGLAAYLAEKGLTAHFQAMTLSGNITKHGMPTTNTLADSENVERALKLQTKAVQ
LVKPEMEASQIVAALKIQHAFRNHNRWKLMKAAARIQSHFHTWKIRRDFVNMRKKAIKIQ
AAFRGHRVRKQYRKIVWSVGVLEKALLRWRLKRKGLRGVQVKTTKTMNMTPESTGEEEFY
RISRVQAEERMQRSVVRVQAMFRSYRAQQEYRRMKMAHEQAKLEFCDMGQLQ
Download sequence
Identical sequences M0T0E8
GSMUA_Achr5P21190_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]