SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P00950_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P00950_001
Domain Number 1 Region: 308-416
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.87e-17
Family Ankyrin repeat 0.001
Further Details:      
 
Domain Number 2 Region: 61-192
Classification Level Classification E-value
Superfamily POZ domain 0.0000000133
Family BTB/POZ domain 0.035
Further Details:      
 
Weak hits

Sequence:  GSMUA_Achr6P00950_001
Domain Number - Region: 519-591
Classification Level Classification E-value
Superfamily NinB 0.0222
Family NinB 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P00950_001
Sequence length 630
Comment pep:novel chromosome:MA1:6:651938:657090:1 gene:GSMUA_Achr6G00950_001 transcript:GSMUA_Achr6T00950_001 description:"Putative Regulatory protein NPR1"
Sequence
MEPSYLTAATAFSGSDNSSCVHFSGDAAAAAAPDSAPPAAEVEGLRRLSDHLGSAFQSPD
FEFLADARIAVGPPGDGGSAPREVAVHRCVLSARSIVFREEFARRGRGTAAAPVRMELKE
LVKDFEVGYDALVAMLGYLYTGRVAPLPKAVCACVDEECRHDACRPAVDFMAEVLYASSV
FQIAELVSLFQLMLEVSWRVISLYQISHLSILLEMHSSISFVIVSKKRHLLGILDKMAID
DIPVILSVAKLCDSSCANLLSKCIDVVVKSDLDTITLEKKTPPDIVKQIMDLRLNFGLVG
SESSSFPDKHVKRIHRALDSDDVDLVRMLLKEGNTTLDDACALHYAVAYCDSKITTELLD
LALADVNHRDFRGYTVLHIAAMRKEPKIIVSLLTKGARPSDLTLDGRKALQIAKRLTKSV
EYLRSIEEGEASPKSRLCIEILEQAERRDPQVGEASVSLAMAGDDLRGRLLYLENRVALA
RLLFPMEARVAMDIAQVDGTSEFTLGSTSNRSTGNQRTAMDLNEAPFKIKEEHLARMRAL
SRTVELGKRFFPRCSEVINKIMDDDLTEITGLGHHTSEEKRRRFQELQEVLSKAFSQDKE
EFDRSALSSSSSSSSSSTSIDKVCPNKKMR
Download sequence
Identical sequences M0T343
GSMUA_Achr6P00950_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]