SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P01420_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P01420_001
Domain Number 1 Region: 139-245
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 1.15e-30
Family B3 DNA binding domain 0.00000688
Further Details:      
 
Domain Number 2 Region: 54-105
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000981
Family GCC-box binding domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P01420_001
Sequence length 316
Comment pep:novel chromosome:MA1:6:933694:934755:1 gene:GSMUA_Achr6G01420_001 transcript:GSMUA_Achr6T01420_001 description:"AP2/ERF and B3 domain-containing transcription factor RAV1"
Sequence
METSGSEQVCSETEKQSPPPRPSPGGLLRLGSGTSVVLDPEVILEAKLRKLPSSQYKGVV
PQPNGRWGAQIYEKHQRVWLGTFNEEDEAARAYDAEIVDMLRKHTYYDELQQSRRNSGAD
RSKPCPSHEETFGRVYREHLFDKAVTPSDVGKLNRLVIPKQHAEKHFPLQQTSDAACKGL
LLNFEDACGKVWRFRYSYWNSSQSYVLTKGWSRFVKEKELRAGDVITFQRSTGPENQLFI
GCRRRSVGRYAAAGVHAPTTPVEAVRLFGVNIVKIPVAVSGGVMDGDGIGWNGKRSRDMG
LISSRELFKRQSTQAL
Download sequence
Identical sequences M0T390
GSMUA_Achr6P01420_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]