SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P18250_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P18250_001
Domain Number 1 Region: 332-443
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.0000000103
Family Ankyrin repeat 0.0059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P18250_001
Sequence length 620
Comment pep:novel chromosome:MA1:6:12394803:12401252:-1 gene:GSMUA_Achr6G18250_001 transcript:GSMUA_Achr6T18250_001 description:"F-box/ankyrin repeat protein SKIP35"
Sequence
MEVECKTVMTREDCMHLVQERQPEKDFDENGGLRAVHDGDEGEKVDGSNVVLLPLPADDH
RISKDYACDGMKVGSRASNPLEELAVQTKEQGKNKQGKKLSRRDRMELGRLFQEAVSSHD
WELAESLVLLADSQTLNDVLCIALDAIWFLTTWGELNGITGLIKKIVSYGGSDFTRAILR
TSFFASCVYACHCRIMNLTDTVGIMAQRLHERLQECHGDEVLKAEAGMKVQKFTDWALKC
IGFHFRYQENRGGRKNNMIVEVQLQLSAFKTFLELAGDHLTGKDFTEAFDAACFPLTLFS
SSFDSGWALGISAIAVQGLLGMLVEGGADNVNQCFLEASRFGSTELVRILLQIAERNSLD
IDVDLALVFASHYCKIGTMECLVDEGHAVDFLGPLVRASERGCMQVVQWFVNRGCGDMEL
CLALTAATSSSQVGVSAYLLPHIPQHVLAALSIEILKAAGERSRGSLDGVAFLLCSDFLG
DPAATYAVADSIARSNDEAVAPELRAFLLEQWSEAAFAEGLSSGQDHFVNFMRILRRGCS
PICLMDLPPPLAATIAYMPLYRECMEAGGQLLSQKLRGQLVEAARRIGGRWVDDDSQANE
LLEILERNLPRFFLQPLTTL
Download sequence
Identical sequences M0T823
XP_009404918.1.42102 XP_018682344.1.42102 GSMUA_Achr6P18250_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]