SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr6P29170_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr6P29170_001
Domain Number 1 Region: 18-368
Classification Level Classification E-value
Superfamily NagB/RpiA/CoA transferase-like 8.37e-108
Family IF2B-like 0.0000000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr6P29170_001
Sequence length 385
Comment pep:novel chromosome:MA1:6:29451684:29457558:-1 gene:GSMUA_Achr6G29170_001 transcript:GSMUA_Achr6T29170_001 description:"Methylthioribose-1-phosphate isomerase"
Sequence
MSAEANGSSAAATTAGGSLQSICYERGSLRLLDQRKLPLETVYLDVKDSTDGWTAIRDMV
VRGAPAIAIAAALSLAVEVWNLDFNGTSEDASSLLIKKLEYLVSSRPTAVNLSDAVEKLR
SLVLKTVETATEAKTVFQAYIDAAETMLIDDVASNKAIGFHGAKHLRSNLDSLEKISVLT
HCNTGSLATAGYGTALGVIRALRSEGFLEKAFCTETRPFNQARCSTTGSRLTAFELVHDR
IPATLIADSAVAALMKAGCVNAVIVGADRIAANGDTANKIGTYNVALSAFHHGIQFYVAA
PITSIDLSISSGEQIVIEERSAKELLHSDGGRGKQVAASGISVWNPAFDVTPARLITAII
TEKGVIIKKASDEAFDIKGFIENAK
Download sequence
Identical sequences M0TB62
GSMUA_Achr6P29170_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]