SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr7P09190_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr7P09190_001
Domain Number 1 Region: 256-367
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.15e-16
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 54-184
Classification Level Classification E-value
Superfamily POZ domain 0.000000000212
Family BTB/POZ domain 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr7P09190_001
Sequence length 575
Comment pep:novel chromosome:MA1:7:7525315:7530430:1 gene:GSMUA_Achr7G09190_001 transcript:GSMUA_Achr7T09190_001 description:"Putative Regulatory protein NPR1"
Sequence
MEDNYLTAAPAFSVSDNSRSVHFAGGASPDPAADVEALRRLSDNLGAAFESPDFELFADA
RIAVEDGGAPAREVGVHRCVLSARSPFFREVFAEREGALAPVRLELSKLVSGFVVGYDAL
VTVLGYLYRGRVAPLTKEVCMCVDEECRHEACRPVVDFMVELLYASFVFQISELVSLFQR
HLLDILDKVSIDDIPVILSVANLCDSSCAKLFNKCIEIAVKSDLDIITLEKTMTPDIVKQ
IMDSRLNLGTVGPESINFSDKRVKRIHGALDNDDVDLVRMLLKEGNTTLDDACALHYAVA
YCDSKVTTELLDLELADINHRNIRGYTVLHIAAMRKEPKIIVSLLTKGARPSDLTLDGRK
AVQISKRHTKSMEYFKSTEEGQASPKSRLCIEILEQAERRDPQVGEASAFLAIAGDDLRG
RLLYLENRVTLARLLFPMEARVAMDIARVDGTLEFTLGSTTSHSTGNQRTAADLNETPFT
IKEEHLARMRALSRTVELGKRFFPRCSAVINKIMDDDSTDFAYLEHDASEEKRMRFLELQ
DALSRAFSEDKEEFNKSALSSSSSSTSVGIVPTQR
Download sequence
Identical sequences M0TG07
GSMUA_Achr7P09190_001 XP_009408867.1.42102

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]