SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P05490_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P05490_001
Domain Number 1 Region: 267-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.35e-17
Family Ankyrin repeat 0.0013
Further Details:      
 
Domain Number 2 Region: 41-183
Classification Level Classification E-value
Superfamily POZ domain 0.000000000000235
Family BTB/POZ domain 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P05490_001
Sequence length 581
Comment pep:novel chromosome:MA1:8:3581050:3584968:-1 gene:GSMUA_Achr8G05490_001 transcript:GSMUA_Achr8T05490_001 description:"Putative Regulatory protein NPR1"
Sequence
MEASQPFSDSDATSSSLCHPVAVAVAVAGQTVAAAEVAALSRLSEQLGFLLRSPGLSFCS
DARITVRSSGGEPPRVVPVHRCLLAARSPFFRDKFAGGAAALELGEMVNGFEVGCEALEA
VLQYVYTGRLEELPRGVAECVDEGCCRHEACWPAVHFMLQVLHAASTFEINELVSLFQRQ
LLNILQKVATDDILMILLVANLNNKLCQRLLTKCIGMVVQSDIDYVALNKKLPPDIVEQI
KQSRSNFGLDGQENLEFPEKHVKSVYGALDSDDIELVKLLLEEGGTTLDNAKALHYAVAY
CDSKITKELLSLGLADVNGRDHRHYTVLHIAAMRKEPEIIMSLLTMGARPFDHTSDGRTA
LQISKRLTRSTDYYRSTEQGEPSPRERLCIEMLEQAEMRDSFMEVTSVPVEMISDNLQER
LLYLESRVWLAESLFPTEAKAAMNNANVDGTLRFKSSCLTNLISGNKRSAEDVVKASFKM
TEKDFSRMEALTKTVQLGMHFFPRCSKVIDKFLGDDLSGLSIVEHINTEERKNRYNEILE
EMNMAFTQDKNEKAFGRSAASCSAASSSKSARAARNKVAKK
Download sequence
Identical sequences M0TMV2
XP_009412232.1.42102 GSMUA_Achr8P05490_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]