SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr8P14650_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr8P14650_001
Domain Number 1 Region: 134-240
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.49e-28
Family B3 DNA binding domain 0.00011
Further Details:      
 
Domain Number 2 Region: 39-94
Classification Level Classification E-value
Superfamily DNA-binding domain 0.000000000000203
Family GCC-box binding domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr8P14650_001
Sequence length 414
Comment pep:novel chromosome:MA1:8:12029784:12031115:-1 gene:GSMUA_Achr8G14650_001 transcript:GSMUA_Achr8T14650_001 description:"Hypothetical protein"
Sequence
MISVATTMAAGREGSDSNSIVNWVSFAPCMATTSNTSTRYKGVMLQQNGHWGAQIYAHGH
RIWLGTFKSEQAAAAAYDSAAIKLHHGDSHRNLPATPLTAHEHKFQETFTTDEAAPRPSL
PHAGTSGNVAFLEMFLKELTPSDVGKLNRLVIPKKHATKYFPQVASVTADEVMVEFVDRE
DRSWTFRYCYWKSSQSYVFTKGWNKFVKEKRLQAKDTVAFYRCEERDGLRRTYCLIDIIR
CSGDGHRTSGFSWSKNGAVGLGLSCKRKPEEGDEEGNRTSGFSWSKNGTVGLGLGCKRKT
EEGDEEGDRSSGYSGRSGNGAMGLGLGLKRKTVEGDEEGDRSSGFSGSRSGAMGLGLSFK
RKTKEEDEVGEVVSGLAVTQKSSEARQQEEEEQEKRKKRLRLFGVSITDTNDRG
Download sequence
Identical sequences M0TQG8
GSMUA_Achr8P14650_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]