SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_Achr9P04910_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_Achr9P04910_001
Domain Number 1 Region: 98-313
Classification Level Classification E-value
Superfamily 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 1.09e-50
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, substrate-binding domain 0.0000363
Further Details:      
 
Domain Number 2 Region: 18-100,183-193
Classification Level Classification E-value
Superfamily Alkaline phosphatase-like 0.00000575
Family 2,3-Bisphosphoglycerate-independent phosphoglycerate mutase, catalytic domain 0.0056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) GSMUA_Achr9P04910_001
Sequence length 326
Comment pep:novel chromosome:MA1:9:3191011:3193796:-1 gene:GSMUA_Achr9G04910_001 transcript:GSMUA_Achr9T04910_001 description:"2,3-bisphosphoglycerate-independent phosphoglycerate mutase"
Sequence
MGSPEFSSKLADHPRLPKRKTVAVVILDGWGEANPDQYNCIHVADTMSLPATICWCSREM
EIAEGSWYSGRVGLPTDDDMGNSEVGHNALGAGRIYAQGAKLVDLALAFGEIYEGEGFKY
IKECFDKGTLHLIGLLSDGGVRSRLDQLLLLLEGAGEHGAKRIRVHILSDGRDDLDGSSV
RFVEILENELSKLREKGIDAQIASGGGRMYVRMNRHENDWGVVKRGWDAQVLGEAPYKFQ
SALEAIKKLREDPKANDQYLPPFVIVDESGKAVGPIVDGDAVVTFNFRADRMVLIAKALE
YENFDKFDRVRFPKYDMLECFNMMGN
Download sequence
Identical sequences M0TXK0
GSMUA_Achr9P04910_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]