SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for GSMUA_AchrUn_randomP01860_001 from Musa acuminata 22

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  GSMUA_AchrUn_randomP01860_001
Domain Number 1 Region: 155-217,265-366
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.29e-17
Family Ankyrin repeat 0.0011
Further Details:      
 
Domain Number 2 Region: 43-184
Classification Level Classification E-value
Superfamily POZ domain 0.0000000000228
Family BTB/POZ domain 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) GSMUA_AchrUn_randomP01860_001
Sequence length 575
Comment pep:novel chromosome:MA1:chrUn_random:8489437:8494426:-1 gene:GSMUA_AchrUn_randomG01860_001 transcript:GSMUA_AchrUn_randomT01860_001 description:"Putative Regulatory protein NPR1"
Sequence
MEPEDSQLFSDSDITTTSSLCYPPAVAAAAEPLPSAEVAALTRLSEHLGSLRRSPGLVFC
ADACIIVRSSVGDPPLEVPVHRCVLSARSPFFLEKFAAGSVALELGELVAGFEVGREALE
AVLEYIYTGRPEELPRGAAECAEESCHRHEACWPAVHFMLQVLHAAFRFEIYELVSLFQR
RLLDILEKVATDDILLILIVANLCNKHCQRLLLKCIEMVVKSDIDYMTLEKKLPGNVVKQ
IVKFRSSLGSDGQSLGFPDKHVKSIYVALDMDDIELIKMLLYEKHTTLDDAKALHYAVAY
CDPKTTKQLLDLELADVNGKDHRGYTVLHVAAMRKEPEIIMSLLTRGAQPSYITSDGRTA
LKISKMHTRSIDYCRPVKRGETSPKERLCIEMLERAEAKDSPTEATSVPVEMISDNLREK
LLYLESRVWLAERLFPAEAKTAMNNANVDGTLKFKSSSLLQPCAGYKRSVDDVAKASLEM
TAEQLSRMEALSKTVQLGMRFFPRCSNIINKILCDDLSELSIVERVDTEERKNRYNEILE
EMKKAFTEDKKKFDGSASASSSKSARAVRARVAKS
Download sequence
Identical sequences M0U5J8
XP_009385599.1.42102 GSMUA_AchrUn_randomP01860_001

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]