SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000000940 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000000940
Domain Number 1 Region: 1212-1551
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.26e-83
Family p120GAP domain-like 0.0000000000601
Further Details:      
 
Domain Number 2 Region: 1586-1725
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.0000116
Family CRAL/TRIO domain 0.016
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000000940
Domain Number - Region: 1857-1889,1921-2013,2124-2157,2200-2284
Classification Level Classification E-value
Superfamily ARM repeat 0.000789
Family PBS lyase HEAT-like repeat 0.077
Further Details:      
 
Domain Number - Region: 680-791,829-841,890-1057,1101-1196,1250-1316,1355-1372
Classification Level Classification E-value
Superfamily ARM repeat 0.00259
Family PBS lyase HEAT-like repeat 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000000940   Gene: ENSTNIG00000004988   Transcript: ENSTNIT00000004001
Sequence length 2839
Comment pep:novel chromosome:TETRAODON8:16:8973959:8995619:-1 gene:ENSTNIG00000004988 transcript:ENSTNIT00000004001 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAHKPVEWVQAVITRFDEQLPIKVGHQNTHTKVSTEHNKECLINISKYKFSLVISGLTT
ILKNVNNMRIFGEASEKNLYLSQLIILDTLEKCLAGQSKDCLRLDETMLVKQLLPEICHF
IHTYREGHQHAAELRASASAVLFSLSCNNFNAVFSRISTRLQELTVCTEDNVDVHDIELM
QYINVDCSKLKRLLQETALKFRALKKPAQLAVINSLEKAFWNWVENYPDEFTMLYQRPQA
DMAGRTWPQHRLTSIRLTFSSQQRSCSTWSAVWPLQTILLILCPEITHTIFQRTQSKTAR
STRKQFLDSLRKALSGQGGSKQLMESAAIACVKLCKASTYISWEDHSTIFLLVQSIVMDL
KALLFNPTKPFWRGTGSQNADVELMMDCFVSCFRITPQNNQHFKVCLASSSPSTFHFVLV
NSLHRIITNSHLDWWPKIDALYCYSGELRFMFSDTLNRVIQGAGTHAPLRTTSSLTFKGK
VTNSLKFKEKTTELDTRSYKCLLLALVKLIHADPKLMLHNPVKQAPEMQSSTAELITGLV
QLVPLTNSTQLSQEAMEALLVLHQPETIELWNPDLPIETFWDISSQVLFLICRRLTSQQM
VNGTDVLKWLREILICRNKFLLKNKCGSPSPTGSASFESVLSEPPFPPAPPFQESATMGG
GIPICRQAQTKLEVCLYMFLWSPDTEAVLVAMSCFRHLCEEADIRSAADEVPVQTILPNY
ATFSELASVSNMMGTAGRSTLQKRVMALLRRIEHPTPGNIEAWEETCSKWDQATKQILNS
PKNKADDGQTLEASAPVFISKPQLLSGLEWLDKIQVAFLHSQQEWINMTGFLCALGGVCL
QQRSTPGPATYSPPMGPSAERKHSMISMGPCDMSTPLVSASSFSSASNESPVSRFLDRLL
SLLVCGHDRVGLHIRTNVKDLLGLELSPALYPMLFNKLRNSIGRFFDTQGPVPINDTNTQ
FVEQTIAIMKNLLDNHAEGSSEHLGQASIETMMLNLVRYVRILGNMVHAIQIKTKLCQLV
EVMMERRDDLSFCQEMKFRNKMVEYLTDWVMGTSNQAADDDIKCLTSRDLDQASMEAVVS
LLAGLPLQPEEGDGVELMEAKSQLFLKYFTLFMNLLNDCSEVEDEGQVVGGRKRGMSRRL
ASLRHCTVLAMSNLLNANVDSGLMHSIGLGYHKDLQTRATFMEVLTKILQQGTEFDTLAE
TVLADRFERLVELVTMMGDQGELPIAMALANVVPGSQWDELARVLVTLFDSRHLLYQLLW
NMFSKEVELADSMQTLFRGNSLASKIMTFCFKVYGAAYLQKLLEPLLRGVITTPDHISFE
VDPTRLEQGENLEENQSNLLQITERFFQAIIGSSSEFPPQLRSVCHCLYQATCHSLLNKA
TVKEKKENMAKVQVVSQRFPQNSIGAVGSAMFLRFVNPAIVSPYEAGILEKKPLPRIERG
LKLMSKILQSIANHVLFTKEEHMRPFNDFVKSNFDAARRFFLDIASDSPPSDSVNHSLSF
ISDGNVLALHRLLWNNQERIGQYLSSNRDHKAVGRRPFDKMATLLAYLGPPEHKPVADTH
WSSLNLTSSKFEEFMTRHQVHEKEEFKALKTLNIFYQAGTSKTGNPVFYYVARRYKTGQI
NGDLLIYHVLLTLKPYYAKPYEIVADLTHVGPSNRFKTDFLSKWFVVFPGFAYENVAAVY
IYNCNTWVREYTKYHERLLTGLKGSKRLQFIDSPAKLAEHIEPDQQKLPAATLTLEEDLK
VFHNALKLAHKDTKVSIKVGSTAVQVTSAERTRVLGQSVFLNDVYYASEIEEICLVDESQ
FTLTMANQGTPLTFMHQECDAIVQSIIHIRSRWELSQPDSIPQHTKIRPKDVPGTLLNIA
LLNLGSSDPSLRSAAYNLLCALTCTFNLKIEGQLLETSGLCIPANNTLFIVSISKTLAAN
EPHLTLEFLEECISGFSKSSIELKHLCLEYMTPWLLNLVRFCKHNDDAKRLRVTAILDKL
ITMTINEKQMYPSIQAKIWGSLGQITDLLDVVLDSFIKTSATGGLGSIKAEVMADTAVAL
ASGNVKLVSSKVVIGRMCKIIDKTCLSPTPTLEQHLMWDDIAILARYMLMLSFNNSLDVA
AHLPYLFHVVTLLVATGPLSLRASTHGLVINIIHSLCTCSQLNFSEETKQVLRLSLTEFS
LPKFYLLFGISKVKSAAVIAFRSSYRDRSFSPGSYERETFALSSLETVTEALLEIMEACM
RDIPACKWLDQWTELAQKFAFQYNPSLQPRALVVFGCISKRVSHGQIKQIIRILSKGLES
CLKGPDNYNSQVLIEATVIALTKLQPLLSKESPMHKALFWVAVAVLQLDEVSLYSAGTAL
LEQNLHTLDSMRVFNDKSPEEVFMEIRRPLEWHSKQMDHIVGLNFSANFNFALVGHLLKG
SYRHPSPTTVARTVRILHTLSLISKHLKCDKFEVNTHSVAYLAALLTVSEEVRSRCSLKH
RKSLLISDLSMDPVPMETYSSHMTDPSCRKLRETQPWTSPQVSERYLSPHYPTVGQISPR
TRKSMSLDMGQPSQANAKKLLAGTRKSFDHLISDSKAPKRPEVESGMTTPPKMRRVAEND
YEIETQRIGNSHLRKVSVSESNVLLDEEVLTDPKIQALLLTVLATQVKYSTDDFDQRILY
EYLAEASVVFPKVFPVVHNLLDSKINTVLSMCQDTNLLNPVHGIVQSVVYHEESPPQYQP
SCLQSFGFNGLWRFAGPFSKQTHIPDYAELIVKFLEALIDSYLPAAEEERGEEQLRTPTS
PYPPSSQSQLSITANLNLSNSMTSLATSQHSPGVDKENVQLSPSSALSSGGRTRHGSASQ
VQKQRSTGSFKRPSIKKIV
Download sequence
Identical sequences H3CHC6
ENSTNIP00000000940 99883.ENSTNIP00000007654 ENSTNIP00000007654

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]