SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002017 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002017
Domain Number 1 Region: 210-461
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.19e-52
Family Protein kinases, catalytic subunit 0.00017
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002017
Domain Number - Region: 148-178
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0971
Family Spectrin repeat 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002017   Gene: ENSTNIG00000010419   Transcript: ENSTNIT00000003572
Sequence length 472
Comment pep:novel chromosome:TETRAODON8:13:13159324:13161704:1 gene:ENSTNIG00000010419 transcript:ENSTNIT00000003572 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDSIGHVLSLASQIYTLVEKVKANKKRCRRVADRVRALEKLLRSYRSREAGGSSADVEQA
LRELSITLSSAQQLIQKYTLSSWVERVLSSRSHGDEFSGVNERLNDAFQALAGAEQLQQG
NLLSKVFELSCRHREDEDDRREDIILFQHVKQQQEKMDAMMRDLQELKASVETVVDAWKK
PSDEVQVTRMIKAEELKFQQPKEPFVRSRTSEVYRGEYNGFQVAIKRYTGQVHASPREVR
EVFTKEVETMRRFESPNIQRVFGICIQDEDGPRPHFLIVMEYCEKGSLRQVLDSDCRLSW
TRRASMSLDAAQGLYRLHQTEEKPKVHGCINSHKFLVSKGYTVKLGGFELAQTESSLRKS
AKNQEARSLHYLPPQLLANIHHPYSKECEVYSFGIVLWEIMTRKKPFEGWSPEQIQQRVC
VERFREPLPADCPAALRTLVDACRAYDSFHRPSAEELLDKLRTVVNQLEEQP
Download sequence
Identical sequences H3CYJ1
99883.ENSTNIP00000013326 ENSTNIP00000013326 ENSTNIP00000002017

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]