SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000002270 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000002270
Domain Number 1 Region: 2364-2487,2519-2664
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.26e-28
Family Nucleotide and nucleoside kinases 0.042
Further Details:      
 
Domain Number 2 Region: 1725-1945
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.06e-21
Family Extended AAA-ATPase domain 0.055
Further Details:      
 
Domain Number 3 Region: 1988-2312
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.25e-16
Family Extended AAA-ATPase domain 0.065
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000002270
Domain Number - Region: 2874-2959
Classification Level Classification E-value
Superfamily Myosin rod fragments 0.000523
Family Myosin rod fragments 0.01
Further Details:      
 
Domain Number - Region: 1167-1237
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0691
Family Spectrin repeat 0.0092
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000002270   Gene: ENSTNIG00000017253   Transcript: ENSTNIT00000001009
Sequence length 4113
Comment pep:novel chromosome:TETRAODON8:10:7800446:7825517:1 gene:ENSTNIG00000017253 transcript:ENSTNIT00000001009 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSMSDGGGTEESSGTMEVSTVQTVADTSVLQKHIRKLVPLLLEDGGEAPASLETALEEKS
AVEQMKKFLADPQIHTILVERSALKEEVGDEGEEEKECITYNISIDIHYGLKSNSLALIK
RTGVIDADKPISTQVRVLTLSEDSPYETLHSFISNAVAPFFKSYIRESGKADRDGDKMAP
SVEKKIAELEMGLLHLQQNIEIPEISLLIHPNIANIAKQCYERGEKPKVTDFGDKVEDPT
FLNQLQSGVNRWIREIQKVTKLDRDPASGTALQEISFWLNLERALNRIQEKRESPEVLLT
LDILKHGKRFHATVSFDTDTGLKQAVETVNDYNPLMKDFPLNDLLSALELDKIRQALMAI
FTHLKKIRNTKYPIQRALRLVEAISRDLSSQLLKVLGTRKLMHVAYEEFEKVMVACFEVF
QTWEDEYEKLQVLLRDIVKRKREENLKMVWRLSPAHRKLQSRLDHMRRFRRQHEQLRAVI
VRVLRPQVSAVPQHAPGETVEPQDLKVATVLFDAADANAIEEVNLAYENVKEVDGLDVSK
EGVEAWEAAMKRYDERIDRVETRITARLRDQLGTAKNANEMFRIFSRFNALFVRPHIRGA
IREYQTQLIQRVKDDIESLHDKFKVQYPQSQACKMSHVRDLPPVSGSIIWAKQIDRQLTA
YMKRVEDVLGKGWENHVEGLKLKQDGDSFRAKLNTQEIFDDWARKVQQRNLGVSGRIFTI
ESTRARGRSGNMLKLKVNFLPEIITLSKEVRNLKWLSFRVPLAIVNKAHQANQLYPFAIS
LIESVRTYERTCEKVEERSSISLLVAGLKKEVQALVTEGITLVWESYKLDPYVQRLAETV
FNFQEKVDDLLLIEEKIDLEVRSLETCMFDHKTFSDILSRVQKAVDDLNLYSYSNLPIWV
NKLDIEIERILGVRLQAGLKAWTQVLRGQVEDKADVDMDTEAPQVSHKPGGEPKIKNVVH
ELRITNQVIYLNPPIEDCRYKLYQEMFSWKMVILSLPRIQSQRYQVGVHYELSEEEKFYR
NALTRMPDGPAALEEAYNAVEDIVGEVEQYVKVWLQYQCLWDMQAENIYNRLGEDLTKWQ
ALLVQIRKARGTFDNAETRKEFGPVVIDYGKVQSKVNLKYDSWHKEVLSKFGQMLGQNMQ
DFHAQISKSRQELEQHSVDTASTSDAVNFITYVQTLKRKIKQFEKNVDVIRNGQRLLEKQ
RFQFPPSWLYIDNIEGEWGAFSDIMKRKDTAIQQQVANLQMKIVQEDKAVENRTTDLLND
WEKTKPVAGNLRPEEALQSLTIYEGNFSRLKDEREKCARAKEALELTDTGVFSGSEERVQ
VALEELHDLKEVWSELSKVWEQIDQMKEQPWVSVQPRKLRQSLDALLNQLKNFQARLRQY
ASYEYVQRLLKGYLKVSDIKHLLPVETQRFQSISTEFLALMKKVSKSPLVMDVLNIQGVQ
RSLERLADLLGKIQKALGEYLERERSSFPRFYFVGDEDLLEIIGNSKNVAKLQKHFKKMF
AGVSSILLNEDNTEVLGISSREGEEILYKTPVSITEHPKINEWLTLVEKEMRVTLAKLLA
ESVTEVTSFNKGTAVDLSQYITWIDRYQAQLVVLSTQIAWSENIESALTTISGGGDMTLM
QAVLSNVEATLNVLADTVLMEQPPLRRRKLEHLITELVHQRDVTRTLIKNKIDNPKSFEW
LSQMRFYFDPKQTDVLQQLSIQMANAKFNYGFEYLGVQDKLVQTPLTDRCYLTMTQALEA
RLGGSPFGPAGTGKTESVKALGHQLGRFVLVFNCDETFDFQAMGRIFVGLCQVGAWGCFD
EFNRLEERMLSAVSQQVQYIQVALREHSNPNRDRIFIGVPVTTELLNKMKVSPDMAIFIT
MNPGAGRSNLPDNLKKLFRSLAMTKPDRQLIAQVMLYSQGFRTAEVLAKKIVPFFKLCDE
QLSSQSHYDFGLRALKSVLISAGNVKRERIQRIKKDKLERGEDVDENEIAENLPEQEILI
QSVCETMVPKLVAEDIPLLFSLLSDVFPGIQYQRGEMTALREELKKVCGEMYLTYGDGDE
VGSMWVEKVLQLYQITQINHGLMMVGPSGSGKTMAWRVLLKALERLEGVEGVAHIIDPKA
ISKDHLYGTLDPNTREWTDGLFTTFSESEMKIALKKKKDIFNFMSSQMLNMLTKFHKNTI
KTSRNGGKETATHRKFRTPLKGCPDVLFRFLRHVPVVYVDYPGPASLTQIYGTFNRAMLR
LIPSLRTYAEPLTAAMVEFYTMSQERFTQDTQPHYIYSPREMTRWVRGIFEALRPLETLP
VEGLIRIWAHEALRLFQDRLVGDDERRWTDENIDMVALKHFPNIDKDKALNRPILYSNWL
SKDYIPVEQEELRDYVKARLKVFYEEELDVPLVLFNEVLDHVLRIDRIFRQPQGHLLLIG
VSGAGKTTLSRFVAWMNGLSVYQIKVHRKYTGEDFDEDLRTVLRRSGCKNEKIAFIMDES
NVLDSGFLERMNTLLANGEVPGLFEGDEYATLMTQCKEGAQKEGLMLDTHEELYKWFTSQ
VIRNLHVVFTMNPSSEGLKDRAATSPALFNRCVLNWFGDWSTEALYQVGKEFTSKMDLEK
PNYKVPDYMPIVYDKLPQPPSHREAIVNGCVFVHQTLHQANNRLAKRGGHTMAITPRHYL
DFINQYANLFNEKRSELEEQQMHLNVGLRKIKETVDQTKKVEELRRDLRIKSQELEAKNA
AANDKLKKMVKDQQEAEKKKVVSQEIQEAVYKQQEVIKDKQQSVKHDLDQVEPAVIEAQN
AVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTVDWKQIRSIIMRENFIPTIVNF
SADEISDSIREKMKKNYLSNPGYNYDQINRASLACGPMVKWAIAQLNYADMLKRVEPLRN
ELQKLEDDATDNKTKAEEVEQMIRDLEASIARYKEEYAVLISEAQAIKADLAAVEAKVNR
STALLKSLSAERDRWEKTSETFKNQMSTIAGDCLLSAAFITYAGYFEQQMRQNLFTTWSH
HLQQANIQFRTDIARTEYLSNADERLRWQANSLPADDLCTENAIMLKRFNRYPLIIDPSG
QATEFIMNEYKDRKITRTSFLDDAFRKNLESALRFGNPLLVQDVESYDPILNPVLNREVR
RTGGRVLITLGDQDIDLSPSFVIFLSTRDPTVEFPPDLCSRVTFVNFTVTRSSLQSQCLN
EVLKAERPDVDEKRSDLLKLQGEFQLRLRQLEKSLLQALNEVKGRILDDDTIITTLENLK
KEAAEVTRKVEETDIVMAEVETVSQQYLTLSSACSSIYFTMEALNQMHFLYQYSLHFFLD
TYHTVLYENPNLKSISDHSQRLAVLTKDLFQVVFNRAARGMLHLDHITFAMLLAKISLKG
MTSEPSYDSEFQHFLRGKEIVLTGTSLPKVKGLSSEQSEAMVRLSRLPAFSDLVNKVQAD
EQFFMWIESNTPELAVPYLWSEEKQSTPIGQAVHQLLLIQAFRPDRLLAMSHIFVAKVLG
ESFMSIIEQPLDLANVVENEVKPSTPVLMCSVPGYDASGLVRDLAAEENRQITSISIGSA
EGFNKADKDINTAVKSGRWVMLENVHLAPAWLMHLEKKLHSMHPHACFRLFLTMEINPKV
PVNLLRAGRIFVFEPTPGVKANMLRTFSSIPVARMCKAPNERARLYFLLAWFHAVIQERL
RYAPLGWSKKYEFGESDLRSACDTVDTWLDDTAKGRQNIAPDKIPWAALKTLMAQSIYGG
RIDNDFDQRLLNTFLDRIFTKGSFDSEFKLALKVDGHKDLKMPDGIRREEFMHWVEMLPD
TQTPSWLGLPSNAEKVLLTTQGTDMMGKMLKMQMLEDEDDLAYETEKKERTSSTSDTQPA
WMRTLHTTACNWLQLMPQSVNPLKRTVENIKDPLFRFFEREVKMGGKMLQDVRQDLSDVV
QVCQGKKKQTNYLRTLISDLVKGILPRSWCRYTVPASMTVIQWVADFSERIKQLQMISQG
AATGGAKELKNIHVCVGSLFVPEAYITATRQYVAQANSWSLEELCLEVNVTTAQGASLDA
CSFGIKGLKLQGATCANNKLSLSTTISTELPLTQLRWIKHSSTEKRHTVKQVTLPVYLNF
TRSDLIFTVDFDIATKEDPHSFYERGVAVLCNE
Download sequence
Identical sequences H3DIP7
99883.ENSTNIP00000020391 ENSTNIP00000002270 ENSTNIP00000020391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]