SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000003834 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000003834
Domain Number 1 Region: 563-751
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 6.94e-53
Family DBL homology domain (DH-domain) 0.000000153
Further Details:      
 
Domain Number 2 Region: 755-879
Classification Level Classification E-value
Superfamily PH domain-like 1.05e-33
Family Pleckstrin-homology domain (PH domain) 0.00000315
Further Details:      
 
Domain Number 3 Region: 281-394
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000662
Family Spectrin repeat 0.0088
Further Details:      
 
Domain Number 4 Region: 82-171
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000445
Family CRAL/TRIO domain 0.0086
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000003834
Domain Number - Region: 355-494
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00013
Family Spectrin repeat 0.0083
Further Details:      
 
Domain Number - Region: 170-270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0023
Family Spectrin repeat 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000003834   Gene: ENSTNIG00000016837   Transcript: ENSTNIT00000000473
Sequence length 879
Comment pep:novel chromosome:TETRAODON8:1:8822700:8830249:1 gene:ENSTNIG00000016837 transcript:ENSTNIT00000000473 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AEVTVPVSMKEVGGHIEKQVAYLSGGRGEDSSVIITLPECSAFSDIPEEALAKVFTYLTL
IPRTRQPGVKFIIILDRRLDTWASIKTALSRIAASFPGNLHLVLVLRPTSFFHRTVTDIG
FRFSQEDFMLKMPVVMLSSVTDLLRYIDENQLTSEFGGTLDYCHSDWMFLRTAIESFAVT
VKDIAQMLQSFGTELAETELPDDGRDTEHLLETHTAKYRKLKKKKDAIISVSKDGHHLLL
SLETSGKEEDAQWDVRMDWETVQRLYTQLRDMELAFDGFFEKHRLKFHQYLQLLRYEQRF
QEMETRLQDLISEERELLVSASSLAQTEQVLKRFDSLESNAQEVMSQTQIIVLHGHQLSA
GHHYAVALIMQRCNELRHYCDTLDAALKAKRAHLLQTHQLLLCLGQAQTWCDDGAYLLAN
QLVDKLQSKEGAQAALQDIEKFLEEAPSMLSSGPDVLAAEYEGVITPELQTQIGETFEKH
VAVQQMIQNRQACLRKLADKQVRPVQLVAPRPENPPRSKSPFSPKHGCKRNSRFRQFWCV
QIEVIHDYQESRSCVSYGLEGEDSPDLLKRHVMKELFDTERIYVEELLSVLLGYRAEMEN
PALSSLLPPILHSKQDILFGNMPEIYNFHSRIFLQDLEGCLETPESVGACFLERKESFQM
YECYCQNKPRSDALWRQFSDCHFFQECQKNLEHKLGLDSYLLKPVQRLTKYQLLLKELLK
YSTDCKGTSELQGALTAMLDLLKSVNDSMHQIAITGYEGDICELGRVLMQGSFSVWISHK
RGPTRMKELARFKPMQRHLFLYERALLFCKRREEHGDGGDKTPSYSFKHCLKMTAVGITE
NVKGDQKKFEIWYSGREEVYVVQAPTVEVKMTWLHELRR
Download sequence
Identical sequences H3C6G4
ENSTNIP00000003834 ENSTNIP00000003834 99883.ENSTNIP00000003834

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]