SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004060 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004060
Domain Number 1 Region: 281-425
Classification Level Classification E-value
Superfamily Spectrin repeat 2.45e-16
Family Spectrin repeat 0.0039
Further Details:      
 
Domain Number 2 Region: 173-329
Classification Level Classification E-value
Superfamily Spectrin repeat 9.36e-16
Family Spectrin repeat 0.009
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004060
Domain Number - Region: 476-542
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000389
Family Spectrin repeat 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004060   Gene: ENSTNIG00000000279   Transcript: ENSTNIT00000002996
Sequence length 543
Comment pep:novel chromosome:TETRAODON8:3:3677200:3681741:1 gene:ENSTNIG00000000279 transcript:ENSTNIT00000002996 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRERPQRPSFKRVALRQKELEKSTQWAQENDKTLRQIQESLAITDRHLTAYLTDHIDAQQ
IPQEAQKIHSELSSHDVTLGEMRKKKQDKEPPQRIMGQIDLTQKMLTDVWTKFRLFQKPA
NFEARLTECERTLNGVKGQAGMLEIGSVEHDVVQSQLEQCMKLYKVLSEVKGEVETVIKT
GRQVVQRQQTEQPKELDDRVTALKLLYNQLGSQVTESKLALEKILKLSRKLRKELNGLTE
WLATTDAELTKRSSVDGMPSDLEAELSWAQSIHDETERRQPQLQAVVDLAEALKALLRGH
GSLVDDKVSLLRCNWIAVTSRAEEWLNLLLDYQRQMQKLDGGIEEVNGWIDGAEIKMNKM
DSQGPNDAVLKVLRAELEMTRGKMEEVRALAQELMSARGENCQAQVRPKVEQLNQRYDAI
AQRVTCGLTAASAKELEQYHSEAQIWLDLLEEEVKQGENLKEEDFQENKDCEEGAVKELL
MKGENLQKRVPDEDKREQLRLKHNQLNSKYNTVKDLRLLRNRKALAIAPQWYQYKRKSHD
LLA
Download sequence
Identical sequences H3C739
ENSTNIP00000004060 99883.ENSTNIP00000004060 ENSTNIP00000004060

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]