SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004232 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004232
Domain Number 1 Region: 212-319
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 7.19e-16
Family CRAL/TRIO domain 0.0079
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004232
Domain Number - Region: 152-179
Classification Level Classification E-value
Superfamily CSL zinc finger 0.051
Family CSL zinc finger 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004232   Gene: ENSTNIG00000001858   Transcript: ENSTNIT00000004367
Sequence length 325
Comment pep:novel chromosome:TETRAODON8:Un_random:36809629:36811484:-1 gene:ENSTNIG00000001858 transcript:ENSTNIT00000004367 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SGSFRVPEDIQDLELMEEWQDDGFPRPLPESGGSPEPAGSLSGATPISLSLPGAGEGGAK
KRLAAPTLSVTLSPGGRDPQADADGFVALSASPDETPSLDINLEALETPSGSESGTLAEL
EWEDDLPQMVRGGATPSSRAEQCEGLMELDQVDASGRRWRRFCTCGQEYRVNMSVLEPYL
QVLSHGGYCGDEMNAIILFTSCYLPENTVENYDYIMDHLFRYIVGTLDLMVSENYLLVYL
CSMAPRNKLPAIRWLHQCYMSIDRRLKKDLKALLVVHPAWYIKALVTLVKPFISDKFSKK
IRFIQNLQDLSKIIPTDRLQIPDAI
Download sequence
Identical sequences H3C7L0
ENSTNIP00000004232 99883.ENSTNIP00000004232 ENSTNIP00000004232

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]