SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004318 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004318
Domain Number 1 Region: 1939-2172
Classification Level Classification E-value
Superfamily Plakin repeat 1.01e-69
Family Plakin repeat 0.000000229
Further Details:      
 
Domain Number 2 Region: 2246-2286,2335-2530
Classification Level Classification E-value
Superfamily Plakin repeat 5.23e-64
Family Plakin repeat 0.000000301
Further Details:      
 
Domain Number 3 Region: 1700-1931
Classification Level Classification E-value
Superfamily Plakin repeat 3.14e-61
Family Plakin repeat 0.00000581
Further Details:      
 
Domain Number 4 Region: 749-859,886-913
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 5 Region: 152-262
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000471
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 6 Region: 2185-2236
Classification Level Classification E-value
Superfamily Plakin repeat 0.000000102
Family Plakin repeat 0.0096
Further Details:      
 
Domain Number 7 Region: 66-156
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000331
Family Spectrin repeat 0.003
Further Details:      
 
Domain Number 8 Region: 1656-1692
Classification Level Classification E-value
Superfamily Plakin repeat 0.0000366
Family Plakin repeat 0.0034
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004318
Domain Number - Region: 658-786
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00304
Family Spectrin repeat 0.016
Further Details:      
 
Domain Number - Region: 267-326
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0134
Family Spectrin repeat 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004318   Gene: ENSTNIG00000012317   Transcript: ENSTNIT00000004456
Sequence length 2566
Comment pep:novel chromosome:TETRAODON8:1:22778227:22791607:1 gene:ENSTNIG00000012317 transcript:ENSTNIT00000004456 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AKDTIEQLKALALDLRQQGQPNDNVVRTLEMCRDQLKGVHQAITGTAHRRRSTRGSGGAV
WEDPGRNFQDAMSWIAQQKVSTHPIITASWGEDPAAIEQQLVGHQRFHSSIQRSAEVERA
REELMKKGDRGNLYALDQEWDSLQKMSFGRTQQLQELQQIMQEMSKEIMWVNDREEEELV
FDWGDKNIDQYIPRKQESYSKLMSDLEVKERELNKLKAKADALLKSNHPASDKIEAYRDT
LQTQWSWLLQITKCIDVHLKENAAYNQFFKEANDTYIKLQKEHETVRKKFTCNKNTSLED
LLQLLQRLERERERIKGNKRQVQHLVANSKNIVRLKPRNPEEKSSSPVIVKALCDFIQDQ
KVICKGNEAILKNNSQRSKWEVTGPGGLDMTVPSVCLIIPPPNPLSVGLANKNEQYYEAI
LSIWNQLYINAKSLIAWQYCILDIKRINSLTISMLAKMRPEEYRQIIKSLETHFEEFKVS
SQDSQMFADEDKKSMEHQVNGAQTHYDQLVVQLPVYIAHQEQWEVQQVAAEEEAVRLEEE
RRRVETKKQVAKKESTTKNLSDLHALRLRLEGAEGTLSQHVHICLGDDAVYDCGLKITQL
ESVLLDIDSMREEYQRLRERIVKELESMSDPDKVQFLRSEITIIDQRLAGLEGGSSAHLQ
RLRALRDLLESLSRAEDIVKVHEARLAEKETTSLTPSEVQDYVLTLKNIKAQLDQKKDVL
ASMETELAKVSHWTSQVGGAWPKCDMMLSRYTEQVGLLGDRWRRINGQIDTRLQDLQSYQ
PQLQRYQESSASFDNWIEATRRKQQSLQTTKIDNIQTLTDHINQQKALNSEIKSKREILD
GVLKDNTACGDAIRDYESDLAAYTSGLETLLNIPIKRTMLKSPTVDLNQEAAQLQTRYME
LLTMSADYYRFLGDLLKNMEELKIRNTKIDLLEEELHLLKENIQNSNAKNKALDDDLGRH
KLELSQLRDNLLSVEEVKETTVLKCNAAKQSLDSTQSKLSELSDQVTRLSYMLEEEKRKR
RLAEERYSHQQEEYDSVLRRRQKELETLSWSKMELEKNFANKEHEIELLRRQLDEGAEKV
KELQAAMSKVRSQCLLEISKIKISYESQIQASHADMETLASQREEDTAAFRTQQDRLVAE
RGNLEEELRRLSSELEEQKKRAEEEVHHQRIAIAEEERRRGELEAQVEALMRQRDEDRRC
HRDELDKITKSLKEKSDQVVYTTHNLEEETRRRRGEEERVGLLEKSLAQLQMKLTGSSVA
AAQLEECKAELEKMSLDLERESKEKIWVKQSLRRTQGRMKDLQALRGSLENQVENLRKDN
QEEVCRRRQIKAELEKTKLAISDYENKIAKLQQNQDRASVSEKRTEGEHLKLKEELERSL
DKTRTSEAHVTRLRAEIRELQQQQVQEQARLEEANLRNEDLQRAVEEKRRALMETSCEVQ
RLQQLSASQTKEKLKLEEDLRAARQNAESLACRQGDEFSSRITSLELQLQASERSNIDHR
SLVSELSSERESLQTQVTEYLDESYQTSLSLHSLQSQHTEVVAERDALLLKLQWTGKDKD
RLQKLEEELIQIKLTLESELRNKQTLMDENQRLKNEEGHWKNQYDGNQSLIRQYAADKEH
LEMEKNSLRSDIEKLKRELRELEDRYKIQLTSIQNELREDPETELNVSYRALIERCLTEP
HTGLQLLPISEKTDPSKLLFDGVRKDVTAQQLLDCGVLDRLTFDQLVKGEKNVSEVAIDK
KLFLKGTGSIAGVAAGPFGKMSFTEAKKQKMMSPESADLLLEAQAATGHLIDPRTNGKMT
VKEACANGVMDPEDEPKLLVAEAAAMGYLDPHSGTILSAGQAVNKGLLNKDTALRLLQAQ
QSVGGILDPTLSVFLPKDIAINRGIIDEDLYGALNRYPQCYLDPDSQQATTYLSLKTKCK
IDPNSGFLLLPEPEKPLTVQGLRGHVSVIDLVEANLLERHDIDRVREGWLTKQQIESSLY
SYLRGSTCIAGVYTDQAMPIYRAMKEGLLQPYSALELLEAQAASGFIVDPVNNLYLTVTD
AYTRNLFGPEFKGNLQAAEKAVTGYKEAGTDKTISLFQAIERGLVDKGRGMRLLEAQIAS
GGVIDPEHGHRVNMDVANRRGYFDEKMSKVLSVQSADYKGFLDPNTDENLTYAELKKRCI
TDKTTGLILLPILDESKKESTTKNTLRKRRVVIVDPETNRQMTIREAYDKGYIDSQTFLE
LAKQECEWEEITIVDPDGSTRFVIIDKKTEKKYDITELLEKRLISQSDLDRYRSQSITLN
EFANIITKRTSAASAASSVTSVTSLSSSTSPVEFSSSSKTLETSGPLIIKSTSTSEAPGE
QEPVGAIFDTENLQKISVTEALNCGLVDSVTAQRLLEAQACTGGIINPINGQKLGLQEAS
RLGIITEDMGSRLKPAQKAYFGFEDIKHKKKMSAAEAMKEMWLPYEAGQRFMEFQVVTGG
LYDPEVKCRRTIQDALEMGWLDERTAHKLQDVAHHTKNLTCPKSKLKISYKEALDNCMVE
QETGVKMLQASSVSSRGISSPYNVASAPGSSTGSRSGSRRSSRRSS
Download sequence
Identical sequences H3D447
ENSTNIP00000004318 ENSTNIP00000015285 99883.ENSTNIP00000015285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]