SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004501 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004501
Domain Number 1 Region: 947-1053
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000108
Family Spectrin repeat 0.008
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000004501
Domain Number - Region: 693-749
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00104
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 821-906
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0137
Family Spectrin repeat 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004501   Gene: ENSTNIG00000002072   Transcript: ENSTNIT00000004642
Sequence length 1061
Comment pep:novel chromosome:TETRAODON8:10:13192015:13242743:1 gene:ENSTNIG00000002072 transcript:ENSTNIT00000004642 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SLTMSVAALSPVAPEPMLTSVTPGSPALEHASPTSVPLSLDPDGGSSPGLRSDGAEPQLG
GSSKPPPLHTTADWKVVLHLPEIQTWLRATSHRVTQLTHSVGQDAHGRHVDVHLVQLKDI
CEDISDHVEQIHALLETEFTLKLLSYSVNIIVDIRTVQLLWHQLRVSVLVLKERLLQSLQ
DSNGNFTRQTDILQAFSEDQHQTRLDALTEVDDCGQLTIRCSQDYFSLDCGITAFELSDY
SPGEEPGGRGAELKTQETSRDVNQEPEERPEPSGLPNLNLRTGWCDVAAPGDASPQAVGL
STEAPPRPPSPPRRAALLSDAGTQEPADISGLQLQAEMSRSTPSVADRTRFWLELDSVYP
DNVSQSCENLQVLNRRNLQANLSRPPGESVKSRSEPRSCGASAHSPLLLEEPATQDTVTQ
RRRGSSEEAHVLSEDDSGSSLPSPVRTQYFSSDMEASGEESEPRPAPVWIGRQQGQKGAP
VRSPEKQHWYGSEEFLALPAQLRKTEMLALKLESLARSIPLGRGDPTQEALQDVDDWDLM
EVNSDGDLFPSRRNHRHFSSASSSDTGPSLDGSIESGPLSDLQSDEDEVPGPTSSPPGVG
VFDGPAARRPVSEQWETGRQQPPINTRLIQRGQENERGRGGDERVKSKVGASLRRGQRWP
GCLLIGWNLSEGWAGPQRKSSSLLVCVVEFLSFKLSVDSRSALKESIMEEGSALLSVITS
HQSGSLKDILQMVSSQWDQLQRQIRRQHSWMLRALRCVQARLLYTHPQSQEEESAGKVKA
ELVSNQYDAQRVALETMAVRLSSLQYPTATDSGQSAQNARNNSLQQCESDYQELWDWLMD
MDAMVTDSHQLMMSEEQRRQLFKSSRVELTMMESKKSSLLRRSRRHGNLQHKIHQLTHTW
EQLEKRFRPPLQAILSEPSGSGCQPSPLDRDVLENPGSPSSSLSNALLEQLEARVKELKV
WLRDTELLIFNSCLREHKEAAQQLHSFKCLSSEVRARRRGVSSVLKLCQKLLQVGVGPEA
EQHREALQLLSINLERRWEAIVMQALQWESRLRRELGEEQV
Download sequence
Identical sequences H3C8C9
ENSTNIP00000004501 ENSTNIP00000004501 99883.ENSTNIP00000004501

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]