SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004740 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004740
Domain Number 1 Region: 437-593
Classification Level Classification E-value
Superfamily Spectrin repeat 6.48e-18
Family Spectrin repeat 0.0074
Further Details:      
 
Domain Number 2 Region: 347-485
Classification Level Classification E-value
Superfamily Spectrin repeat 1.57e-17
Family Spectrin repeat 0.0049
Further Details:      
 
Domain Number 3 Region: 257-383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000314
Family Spectrin repeat 0.0032
Further Details:      
 
Domain Number 4 Region: 3-155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000144
Family Spectrin repeat 0.0077
Further Details:      
 
Domain Number 5 Region: 848-980
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000864
Family Spectrin repeat 0.019
Further Details:      
 
Domain Number 6 Region: 163-270
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000389
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 7 Region: 776-881
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000327
Family Spectrin repeat 0.0083
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004740   Gene: ENSTNIG00000003063   Transcript: ENSTNIT00000004885
Sequence length 1107
Comment pep:novel chromosome:TETRAODON8:14:2163602:2172082:1 gene:ENSTNIG00000003063 transcript:ENSTNIT00000004885 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
YSQTLEAGRQCYQRGTDSEHQNRLQAELQDLEKTWDKTQAGLEGRCQLVQAGVQKWSRCQ
DAVASLVSQLEELETALKEPGPGPGCTGEEHVEVIKEWERALRRWAGRLGELSAMEADLA
QYVAAGDSALLEQQLEQLQGQWDELCTKVSSRRQEIADRLSAWTIFKDKNKEFCDWLSQM
EDKTSRRGDLSIEEMVEKLKKDCMEEINLFSENKSHLKQLGEQLLLASDGAKQAQVRGSL
LEVNQRWHSLFHHIDARVKKLKETLATAQQLDQSMSRLRWWLSGVEAQLSRPVTYSVCHH
QEIQKRLAEQQELQRDIQQHAEGVESVLGLCDLLLRDEDAAGGGELGGDSVQETSRSLDQ
RWRTICALALDRRLRIEETWRLWCKFLDDYARFEDWLKMAERTAANPNSADVPYTVAKEE
LKKFEGLQRQVLERLTQLELVNNQYRRLARENRTDRASQLKAMVHGGNRRWDALHRRVAA
IVRRLKFFTSQREEFEGTRDSLLVWLTELDLQLTNVEHFSESDVHHKIQQLNSFQKEIAL
NTERIDALIVFGEGLIQKSLPQDAALMEDQLEELHTYCQEVFSRLVRFHQRLSQPPLVVE
EPELSSTTFDLETSLELVCRPRWGRSFGSLPATPTHLLASPLERSGRETPLSVDSLPLEW
DHTGDVGGSSTHEDEEEEERAFFSALSGRFFSASSTSVTPRDPPTWQPQGPGWEECEESS
PTLTSTPHKQACLGLMCERGSSSAEDVQRLHDGGVEVANLFLGKISGVSGCRELLQAESD
HREPRRLERDLDDIASWLQSTVPALERMQQTERAAGVEDLRAEARDLREVQKMLARHQPL
VLRVNRLSGEAPGLRSRLGAVNRAWSRACALLQQWDASLRKTLANCQEFHESLHSLLLWL
DHAERRCDAASISQPDTPASALQDHRHTLQALLEELQQRQARHTSLQLLWSQLQPEEAAE
DSLETREKIRVTGSKLRLLLKQVDGGLGALRRHLVSGERAGGSDLCARIRLQPAPLCHQD
RTPPSDLRSGADAPPEVTETRKVSLTQRSELLRVLSGSLALPVSPEPSCLPPCLIPLWVS
HRGCAGTNNFARSFHPMLRYTNGPPPT
Download sequence
Identical sequences H3CBL3
99883.ENSTNIP00000005635 ENSTNIP00000005635 ENSTNIP00000004740

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]