SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000004888 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000004888
Domain Number 1 Region: 1-143
Classification Level Classification E-value
Superfamily E set domains 7.93e-49
Family Cytoplasmic domain of inward rectifier potassium channel 0.0000828
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000004888   Gene: ENSTNIG00000002385   Transcript: ENSTNIT00000005034
Sequence length 168
Comment pep:novel chromosome:TETRAODON8:Un_random:51700689:51701195:-1 gene:ENSTNIG00000002385 transcript:ENSTNIT00000005034 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GKLCLMVRVANMRKSLLIQCQLTGKLLHPSVTQEGEKTLVHQSPVDFYMDSSGDCPFLIL
PLTFYHVLDEHSPLAGLNARNLRRHDFELLVTLNATMESTAATCQSRTSYIPQEILFGYE
FRPVLFSTTGGRYVADFNFFDKVQLSSDSGFHSNDKEKLQLEEDYKKE
Download sequence
Identical sequences Q4TDK9
99883.ENSTNIP00000004888 ENSTNIP00000004888 ENSTNIP00000004888

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]