SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005958 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005958
Domain Number 1 Region: 96-273
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.62e-48
Family CRAL/TRIO domain 0.000000646
Further Details:      
 
Domain Number 2 Region: 16-91
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.0000000000000209
Family CRAL/TRIO N-terminal domain 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005958   Gene: ENSTNIG00000003371   Transcript: ENSTNIT00000006106
Sequence length 306
Comment pep:novel chromosome:TETRAODON8:Un_random:58660742:58663188:-1 gene:ENSTNIG00000003371 transcript:ENSTNIT00000006106 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QSRGHVAGSGCAMAGPQLSELPDHSELLAPALGSLRRGALLLGDLAGVGSFSDGFLLKFL
RARDFDVELALKLLLNYQRWRKESPEISGCLSPSSVLGLLHTSYHAVLPQRDRAGSRVLV
YRIGQWRPGDWSAFQVFRVSLMTSEIISMETETQRRGLKVIFDLEGWSLGHALQINPFLA
RKISSVLSDSFPLKVRGIHLVNEPVFFRPVFAMIRPFLSEKMRQRIHMHGADFQDSLSDF
FPPSVLPPEYGGEGPGIEEACQDWTDRLLQSEALLQQIARHPTGDIAVTPEDPLDSGAET
LPISDG
Download sequence
Identical sequences H3CCI6
ENSTNIP00000005958 ENSTNIP00000005958 99883.ENSTNIP00000005958

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]