SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000005978 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000005978
Domain Number 1 Region: 117-295
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 8.37e-53
Family CRAL/TRIO domain 0.000028
Further Details:      
 
Domain Number 2 Region: 24-102
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 7.98e-18
Family CRAL/TRIO N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000005978   Gene: ENSTNIG00000003391   Transcript: ENSTNIT00000006126
Sequence length 353
Comment pep:novel chromosome:TETRAODON8:14:9443816:9448868:1 gene:ENSTNIG00000003391 transcript:ENSTNIT00000006126 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RGPVAAAPRRAAADGQKRSRMTHLQAGLSPETLEKAKVELKENPDTLHQDIQEVRDMIIT
RPDIGFLRTDDAFILRFLRARKFNHFEAFRLLAQYFEYRQQNLDMFKNLKATDPGIKQAL
KDGFPGVLSNLDRYGRKILVLFAANWDQSRYTFVDILRAILLSLESMIEDPELQVNGFIL
IIDWSNFTFKQASKLTPSMLRLAIEGLQDSFPARFGGIHFVNQPWYIHALYTVIRPFLKD
KTRKRIFMHGNNLNSLHQLIHPEILPSELGGMMPPYDMGTWARTLLEHAYDEETDYCPES
YTLSVQDLERDLEKNLSPKTMKRSQSVVEPGVLKRPDKVKSEEDNMQPLLSLD
Download sequence
Identical sequences H3CCK5
ENSTNIP00000005978 ENSTNIP00000005978 99883.ENSTNIP00000005978

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]