SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006139 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006139
Domain Number 1 Region: 312-468
Classification Level Classification E-value
Superfamily Spectrin repeat 8.64e-27
Family Spectrin repeat 0.0014
Further Details:      
 
Domain Number 2 Region: 521-674
Classification Level Classification E-value
Superfamily Spectrin repeat 1.12e-19
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 3 Region: 209-332
Classification Level Classification E-value
Superfamily Spectrin repeat 2.75e-18
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 4 Region: 1021-1117
Classification Level Classification E-value
Superfamily PH domain-like 0.0000000000000173
Family Pleckstrin-homology domain (PH domain) 0.0011
Further Details:      
 
Domain Number 5 Region: 1-43
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000127
Family Spectrin repeat 0.0091
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000006139
Domain Number - Region: 34-93
Classification Level Classification E-value
Superfamily occludin/ELL-like 0.0112
Family Occludin/ELL domain 0.0056
Further Details:      
 
Domain Number - Region: 662-740
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0249
Family Spectrin repeat 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006139   Gene: ENSTNIG00000003550   Transcript: ENSTNIT00000006287
Sequence length 1117
Comment pep:novel chromosome:TETRAODON8:Un_random:59916599:59930035:1 gene:ENSTNIG00000003550 transcript:ENSTNIT00000006287 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QEGQELIQEQPELRPVVQQKLEEIRQCWAELETTTKARARQLFEQKAQLEVQNYSDLDHQ
LSHLDHQLSHLDHQLSHLEQQPPQLEVMESQVGDLYKNVGQLGGFQTVCLAEPRVGAAEA
EGEELEARAETRIVRLIEPLKERRRILLASKEMHQVAQDLEDEMLWIQERLPLATSKDHG
SSFHSVQQQAKANQKLQRELASRRARIAEVLDRAGMIASLRTPEVDFVREGAEHVHQLWA
VLQAETERRSAVLNAALQAQQYYSEAAKVEAWLADQKLQLATEDKGLDEVSTLQLLKGHQ
SVEQTVEAYAESVGLLSQQCQQLLEVGHPESKSEQIMKQQSHIGRLYLSVKDMVEHRKTK
LEQQYWLYQLHKDVEELDKWITEREVVASSTELGQDLEDVTVLQETFSQFVCETNSLGQQ
RLEQLNKLANEMIKCGHSDAATIAEWKDGLNESWADLLELMETRTQMLAASQQLHRFFTD
CKEVARWPHRQPVPPVPLLTASRLCRSSRRLQMGLTVGLTQVRQLQENASQLRTIYAGEK
AEAILGQEQEVLEAWRQLLSCCEANHVQVTSVTDKVQFFSVVRENLMWMEGIMGQIRWEE
PRDSAALEMMIRQHQELKGKIDGRSKTLQQCGDLGRVLIAAGDPASEEIKEKLDSLLVKQ
RDLVEKWGSHEEKLHKKQERFHVVQETVQPEVWLKATEPERGEAQAQKDEVEQLILRHQA
FRKAAVTWKERFSSLRQLSATEKKQEEISITPHHSVVGSGFRGHPHPGGGGTTSTNYLPQ
GQCSSGLASSAYLAKSGGLMEARLGYAWQNVNSELPQPRVNSLHKAVNPLLEARAMQGHR
CGEAPPANMRGPETGLELLHGRLQRDPRGSRSDPQMDHLRQEREYKLGRQTSSEQEIQAR
LNELPMMVRQERYRRHLERQSSSEKEGSSKQRLQSEKRSTMAEIVEQVQEREAAHALSFG
CFQTRGETYRPSSSLSAPVTRFDGRPRARDRPKPRRRPRPKEPEEARRSRSAPATGAPTT
PQPPSHTAQNEGFLYRKKVTTSDLEGQQRSPNSKSWVNIYCVLKEGKLTFYKDARNHNTT
YNEEPPVDLSTCSFDPSMGYKKKKNVFILQTDDGNFF
Download sequence
Identical sequences H3CD16
ENSTNIP00000006139 99883.ENSTNIP00000006139 ENSTNIP00000006139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]