SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006522 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006522
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily SH3-domain 2.13e-21
Family SH3-domain 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006522   Gene: ENSTNIG00000003915   Transcript: ENSTNIT00000006672
Sequence length 114
Comment pep:novel chromosome:TETRAODON8:2_random:172061:174313:-1 gene:ENSTNIG00000003915 transcript:ENSTNIT00000006672 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
TYVALYKFLPQEKNDLELQPGERVQVFDDSNEDWWKGKSRDKVGLFPANFVQRVRPGERV
WKVTDGFHGNRDKGQMSVKESQICIGKNEETDGFLRLSSGKRRGLVPVQCVQEL
Download sequence
Identical sequences H3CE48
99883.ENSTNIP00000006522 ENSTNIP00000006522 ENSTNIP00000006522

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]