SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000006777 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000006777
Domain Number 1 Region: 111-257
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 5.76e-16
Family CRAL/TRIO domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000006777   Gene: ENSTNIG00000004156   Transcript: ENSTNIT00000006928
Sequence length 316
Comment pep:novel chromosome:TETRAODON8:Un_random:67003300:67006672:1 gene:ENSTNIG00000004156 transcript:ENSTNIT00000006928 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPTTLNVGERKRRTLVAPDMNLSLDQSECSVLSDDFLDTPDDLDINVDDIETPDETDSLE
FINNGNDLEWEDDTPVATAKRLPGEGEEERDSSGRLWRTVIIGDQEQRIDMQVIRPYLRV
VTHGGYYGEGLNAIIVFAACHLPDSSCGDYAYIMENLFLYVVSSLELLVAEDYMIVYLNG
ATPRRKMPGIVWLKRCYQMIDRKLRKNLKCLIIVHPTWFIRTVLAISRPFISVKFMDKIR
HVHTLEELSRFIPMEHVQIPECVQQYDEEKVRSQKERLEQEQQPSNVTPPKESQLEIATF
NQRSRRVNSESALRMS
Download sequence
Identical sequences H3CEV3
99883.ENSTNIP00000006777 ENSTNIP00000006777 ENSTNIP00000006777

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]