SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000007528 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000007528
Domain Number 1 Region: 15-281
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.04e-91
Family Calponin-homology domain, CH-domain 0.00000315
Further Details:      
 
Domain Number 2 Region: 300-421
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-33
Family Spectrin repeat 0.0000843
Further Details:      
 
Domain Number 3 Region: 607-746
Classification Level Classification E-value
Superfamily Spectrin repeat 7.68e-29
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 4 Region: 1015-1172
Classification Level Classification E-value
Superfamily Spectrin repeat 5.56e-28
Family Spectrin repeat 0.0000369
Further Details:      
 
Domain Number 5 Region: 2198-2325
Classification Level Classification E-value
Superfamily PH domain-like 7.4e-27
Family Pleckstrin-homology domain (PH domain) 0.00015
Further Details:      
 
Domain Number 6 Region: 1457-1593
Classification Level Classification E-value
Superfamily Spectrin repeat 9.48e-26
Family Spectrin repeat 0.00049
Further Details:      
 
Domain Number 7 Region: 1228-1381
Classification Level Classification E-value
Superfamily Spectrin repeat 3.67e-25
Family Spectrin repeat 0.00064
Further Details:      
 
Domain Number 8 Region: 1865-2019
Classification Level Classification E-value
Superfamily Spectrin repeat 1.71e-24
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 9 Region: 1652-1807
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-24
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 10 Region: 499-639
Classification Level Classification E-value
Superfamily Spectrin repeat 6.94e-22
Family Spectrin repeat 0.00096
Further Details:      
 
Domain Number 11 Region: 821-955
Classification Level Classification E-value
Superfamily Spectrin repeat 1.77e-21
Family Spectrin repeat 0.0034
Further Details:      
 
Domain Number 12 Region: 430-533
Classification Level Classification E-value
Superfamily Spectrin repeat 1.31e-20
Family Spectrin repeat 0.00038
Further Details:      
 
Domain Number 13 Region: 750-851
Classification Level Classification E-value
Superfamily Spectrin repeat 6.08e-19
Family Spectrin repeat 0.00088
Further Details:      
 
Domain Number 14 Region: 1389-1489
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000158
Family Spectrin repeat 0.0012
Further Details:      
 
Domain Number 15 Region: 2013-2086
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000981
Family Spectrin repeat 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000007528   Gene: ENSTNIG00000019261   Transcript: ENSTNIT00000007688
Sequence length 2340
Comment pep:novel chromosome:TETRAODON8:10:10749495:10764656:-1 gene:ENSTNIG00000019261 transcript:ENSTNIT00000007688 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAAMTSTTDFDNAEITQQYSRVNTRFDLSDEELDNDNSSARLFERSRIKALADEREAVQK
KTFTKWVNSILSRVGCRISDLYLDLRDGRMLIKLLEVLSGERLPKPTKGRMRIHCLENVD
KALQFLKEQRVHLENMGSHDIVDGNHRLILGLIWTIILRFQIQDIIVETGQADQKETRSA
KDALLLWCQMKTAGYPNVNITNFTTSWKDGMAFNALIHKHRPDLVEYNNLKRSNPTHNLQ
NAFNVAEQKLGVTKLLDPEDVFTENPDEKSIITYVVAFYHYFSKMKQLAVEGKRVGKVLD
QAIETEKMINKYETLASDLLAWIEQTILVLKNRKLANSLTGVQQQLQAFNTYRTVEKPPK
FQEKGNLEVLLFTIQSRMRANNQRVYTPREGVLVADINKAWGRLEKAEHDRERVLRDELI
RQEKLEQMARRFDRKAAMRETWLLENQRLVAQDNFGYDLSAVEAAKKKHDAIETDIAAFE
ERVQALVNISKELESERYHDAKRIDVRKDNILRLWDYLQELLKGRRGRLDKNLSLQRIFQ
EMLYIISWMDDMKARLMSPDFGKHLLEVEDLLQKHALLEKDIALQAERVQNASAAALKFA
NGDTYKPCDPQVIHDRVQHLDLCYQELCSLAAQRRAHLEQSRRFWNFLWEVVELDGWIRE
KEHIFSSLDYGKDLTSVLVLQSKHGAFEDELAARRANLEQVVPEGEEMVRSEHLGSPKVQ
EALENIRRQWQQLEELAAFRKQNLQDTQRFFQFQGDADDLRAWLLEAKRQMSSDDVGHDE
YTTQRLLKKHNGLKNEAAKNGATIDALSKQANALPEELQNTPDIQRRLKDIKDLYMELMS
LADLRQKKLDDTMALYTIFSETDACELWMGQKETWLVGLEVPDKLEDLEVVQNRLSMLAQ
DMGNMQARVEEVNKAVKQLEESRHPRTKEVKDCQARLNKRWEAFKAMVEDKKRKVDSAVS
LNNYGLECDETDAWIRDKTRVIQSTQDLGNDLAAVMTIQRKLFGMERDLAAIGAKLDFLR
DEADRLARDHPENAGDILKRRAELDKAWDDLKKTLKDREDSLGEVSKLQTFLQDMDDFQS
WLYKTQKAVASEEIPATLPEAEQQLSLHDAMREDISNHEEDYHRVRDTGARVTRGQEEDP
QYQQLEQRLHGLDRGWYELQKMWDSRKNFLDQGLGFQQFSRDCKAVEAILNNQEYTLAHM
EQPDTLAGAEAASKKHEDFVSTMDANEDKIDGALQSGQRLVDSDNLYSANVRDKMDSIRD
RHSKNKSRAQEVSQRLRDNRDLQHFLQNTQDLTLWINEKMLTAQDTSYDEARNLHSKWLK
HQAFMAELAANKGWLQKVDQQGQALMEAKPEFEPIVRERLAKLHQLWDELEFTTQEKARL
LFDANRSELFDQSLADVKKWLGELQQQLQSGDEEVKDLTSANILLKKHQMTENQVRDRAR
ELEELQEAGRKHGGAREDQPELEAELQALQGEFQQLLTPLEQRRGKLDASKAVHQFYRDL
ANELLWIQERMPLAMSQEHGHNLQSVQMLLKRNQTLQREVEGHQPRVDDVLERGRRMASA
AEGRPEAGRVAEQLKELEDAWDRLQDEMSKRRRLDGSNLAQQYYNDADEAEAWIWEQELY
MIAEEKAKDEQSAMLMLKRHTILKQDVDDYADSIQKLSDRAQRMFAQEHPHGEDIIRRQG
QVDKQYAGLRELAEDRRRKLDHTYHHFLLSREVEDLEHWISERDLVASSQEMGQDLDHVT
LLRDKFREFARETGMVGQERVDLVNLTIDELIEAGHAEAAAMAEWKDGINESWADLLELI
DTRTQLLATSYELLRYFDDGKELVVQIQDKLKELPEDLGEDFSKAESFHRMHAAFERDIT
ALGQQVQQFQETASRLHTQYAGSRADSIRAAEREVAEAWKGLLDACDGRRAQLVDTAEKF
RFFTAVRELMAWMESIIQQIETPEKPRDVSSVELLQKYHQGICSEIEAREAKFAACVQLG
QTLLTRQHRDSAEIEEKLLQLREKKEEMLLKRDERWDWLRLLLEVCQFARDASVAEAWLI
AQEPYVTSRELGFSVHQVDKLLRRHEAFEKSTAMWEERFSALERLTTLELLEFGKQLQDA
EDLEKQEQASDSRREDTGFGEESSQLYTVEEPTVVSHSCLHPSLRQSAAAESTLPIWPMK
ESESLEPEPEPEPSVSTAEAEAEREATVPVEPAGAQAVLQEGPLGRKQDMDGSGKKASNR
SWTNLYCVLKPGQLWAYKDAKSWGHGATYHGEEPLALAGASWELLSSYKKRKHVFKLCLG
DGSEYLFQCRDEEELQRWSRAMQAALQAQAPPDPSASSPAPPEPSRKDKEKKFGRFAKKK
Download sequence
Identical sequences H3CH00
ENSTNIP00000007528 99883.ENSTNIP00000007528 ENSTNIP00000007528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]