SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008295 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008295
Domain Number 1 Region: 9-101
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 4.34e-21
Family Canonical RBD 0.0000292
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008295
Domain Number - Region: 180-239
Classification Level Classification E-value
Superfamily Spectrin repeat 0.014
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008295   Gene: ENSTNIG00000005594   Transcript: ENSTNIT00000008461
Sequence length 285
Comment pep:novel chromosome:TETRAODON8:15_random:3039801:3055026:1 gene:ENSTNIG00000005594 transcript:ENSTNIT00000008461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTGKTQTSNVTNKNDPRSLNSRVFIGNLNTAVVTKADIEAIFAKYGKIVGCSVHKGFAFV
QYASERNARAAVNGENTRVIAGQPLDINMAGEPKPYRPKMGSKRPLSSLYRSDSQIGLLN
LYGYEYDYDYYRDDFYSRLFEYHGRVVPSTRAVIPIKRSRLVVPSTRRAKSSFPGRRALN
VGSSITAPKLKTDQLQTIKKELSQIKSKIDSLLGRLEKIERQHRSETEIQRKQEEVCECL
HGDSVDHSGGEEVEETAEVEAGEMTDGGEDDFEDEGTSDMVSKPS
Download sequence
Identical sequences H3CJ66
ENSTNIP00000008295 99883.ENSTNIP00000008295 ENSTNIP00000008295

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]