SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000008445 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000008445
Domain Number 1 Region: 16-274
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 5.71e-85
Family Calponin-homology domain, CH-domain 0.000000769
Further Details:      
 
Domain Number 2 Region: 289-404
Classification Level Classification E-value
Superfamily Spectrin repeat 2.3e-25
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 3 Region: 635-737
Classification Level Classification E-value
Superfamily Spectrin repeat 6.15e-18
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number 4 Region: 1184-1352
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000658
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 5 Region: 545-596
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000236
Family Spectrin repeat 0.0064
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000008445
Domain Number - Region: 742-824
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000576
Family Spectrin repeat 0.0071
Further Details:      
 
Domain Number - Region: 995-1107
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00892
Family Spectrin repeat 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000008445   Gene: ENSTNIG00000005733   Transcript: ENSTNIT00000008612
Sequence length 1366
Comment pep:novel chromosome:TETRAODON8:Un_random:80483093:80506350:-1 gene:ENSTNIG00000005733 transcript:ENSTNIT00000008612 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREKGNRKKKSLKRSQDKNLRHCVGSNRVFIEDSCFHGVISIMEYRKDERDRVQKKTFT
KWVNKHLVKAQRHVTDLYEDLRDGHNLISLLEVLSGETLPREKGRMRFHKLQNVQIALDF
LKHRQVKLVNIRNDDIADGNPKLTLGLIWTIILHFQISDIQVNGQSDDMTAKEKLLLWSQ
RMVEGNQGLRCDNFTNSWRDGRLFNAIIQKLSIHRPNLIDMGLVYRQSNQENLEQAFSMA
ERELGVTRLLDPEDVDVPHPDEKSIITYVSSLYDVMPRVPDVQDGVKANELELRWQEYFE
LVTMLLQWIRHHVLVFEERKFPTSYEELEVLWHQFLKFKETELPAKETDKNRSKNIFKSF
EGAVQAGHVKIPPGYHPIDVEKEWGRLHVAILERERLLRTEFERMERLQRVVSKVQMESV
VCEEQLNQVEALLQMDMRMLSLGKPAQHMTEMEADLEKAEATIRHLFNDVQLLKDGRHLQ
AEQMYRRVYRLHERLVNLRSEYNLRIKSGVATTQIPMTQIHTSQILQQSSLRMHPELDEV
TVRYIQDLLSWLEENQRRVDEGEWGSDLPGVESQLGSHRGLHQCVQEFCTKIERARGDEG
EVQGKPKNARNKLTILSFALIQSDSKARLSYLEQLHTFVMAATKELMWLNDKEEEEVNYD
WSERNTNMAAKKDNYSGLMRELELREKKMNTVQATGDKLLQDGHPARKTIEAFTAALQTQ
WSWILQLCCCIETHLKQNTAYFQFFVDVKEAEKKIKKMQEAIKRKYTCDRSITVTRLEDL
LQDAADEKEQLNDFKACLEGLKQRAKTIIQLKPRNPATAIKSKLPIQAVCDFKQMEITVH
RGDECALLNNSQPFNWRVLNDKGSESTVPSICFLVSPINKDAVNSVAGLDGNLQKLQVML
QNMFVDMKSLLSWQYLMRDIQIIKSWNLTMFKTLRVEEYQLALRNLDQHYQDFLRDSQDS
QMFGAEDRMQVESSYNRASQHYNTMASGSIEKGEQDELTCKKYLTQIKDLCLRLESCENR
TVMHFRQPMREEPLKACAAKTAQQKKVQAELDGLKKELNLLTEKAEEILASPQQASSSPI
LRSELDITLKKMDRVYDLSLIYLDKLKSIDGMIRNTKEAKDTLISYETRLCDVNQVPADK
KELEDHQKMLKSMHAEAEADQAVFDLLQDDLKRASVINDKMLKIHGEHDAQLEHYRQLVD
SFLERWQAVFAQIDLRQRELNLLGRHMNIYRGSYDYLIHWLIEAKERQEKIQAVPVGDST
VLNNQLAEGKKLLEETERKKDNIEKCQQNTKAYIDSVKDYELHLLIYKALQDPTASPLKK
LKIVSASDDIIQEFVNLRSYYSEMMTLNNQYIKYIIEIKHRLDDEE
Download sequence
Identical sequences H3CJL6
99883.ENSTNIP00000008445 ENSTNIP00000008445 ENSTNIP00000008445

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]