SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009082 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009082
Domain Number 1 Region: 511-713
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.75e-51
Family DBL homology domain (DH-domain) 0.000000381
Further Details:      
 
Domain Number 2 Region: 714-839
Classification Level Classification E-value
Superfamily PH domain-like 2.13e-32
Family Pleckstrin-homology domain (PH domain) 0.0000172
Further Details:      
 
Domain Number 3 Region: 214-351
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000273
Family Spectrin repeat 0.01
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009082
Domain Number - Region: 938-984
Classification Level Classification E-value
Superfamily SH3-domain 0.000907
Family SH3-domain 0.0049
Further Details:      
 
Domain Number - Region: 310-450
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00158
Family Spectrin repeat 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009082   Gene: ENSTNIG00000006322   Transcript: ENSTNIT00000009253
Sequence length 994
Comment pep:novel chromosome:TETRAODON8:7:10298014:10303989:-1 gene:ENSTNIG00000006322 transcript:ENSTNIT00000009253 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DFQLVQFYVTDLPTRDVMRESVCGFNQVTLRRTETTTFGLSCIEDPASTSFPGNLHLILV
LRPSGLSSSAPSPSSSTDLGFRFSQDDFLLKMPVVMLRSVGEQCCVTSIASDFRAKVEYC
QSDWILLRTAIETFAVTVKETAQVLQAFGSELSDTELPDEANAIEFLLHSHSHRYRQMKD
DIRKVLKEGRLLLTNLETVKASKRDAEEERDLRGDMDTVQRLLGQLRDMEEAFDGFFEKH
HLKLQQYLQLLQYEISFQQMEEVLRRLGEQEKAVAPVGTTVVQAEQLLRDLELLDTQAQE
EMARAQMVILHGHQLAANHHYALALIVQRCNELRHLCDVVTAAVRAKRASLTRARDLRRL
EAALRWCDEGAYLLASQMVDRFQTKEGAQEALQSLSTHQERAPSALRNSQGILSLEFEAI
LTPQLQSQISAVSEKLNMVQSMIRNRELCLRKLADVQVRPVQLVAPRPELDQTSQRCKSP
PVQIEVMHDFQGGRGCAYGPLPETDSETEDSPEQVTRPCLVRSHIMKELIATERIYVDEL
LSVLLGYRAEMEDPSLSDLLPSALHSQKDLLFGNMPEIYQFHSRQVFLQDLQGCLETPER
VGSCFLQRKEKFQVYERYCQNKPRSELLWRQCCDSPFFQQECQKKLEHKLGLDSYLLKPV
QRLTKYQLLLKELLKHCREERYRQQLQEALDSMLELLKSVNDSMHQIAITGYQGDLSQLG
RVVLQGGFSVWISHKRAAVRMKEMARFKPMQRHLFLYEHAVLFCKRRDEDSPDRTPFYSF
KSCLRLSAVGVTESVKGDVRKFEICYSGREVVYIVQAPTVEVKVTWLTEIRKILANQVPM
AMCASASASVGGCSVSLPVPHSSTATSHSHRHRGEESTHSSPAHSDPVAPSPRRTWPVAA
HSVAICEGLEDWGAATDFSNISDSDEDDQPAPLVAGRYRVMVESSMASADDIVFNCGDVI
QLLQEELSGMWVVRNISRGEEGRVMSQDLHRILG
Download sequence
Identical sequences H3CLF3
ENSTNIP00000009082 ENSTNIP00000009082 99883.ENSTNIP00000009082

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]