SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009223 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009223
Domain Number 1 Region: 39-290
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.46e-89
Family Calponin-homology domain, CH-domain 0.000000934
Further Details:      
 
Domain Number 2 Region: 309-430
Classification Level Classification E-value
Superfamily Spectrin repeat 5.23e-35
Family Spectrin repeat 0.0000631
Further Details:      
 
Domain Number 3 Region: 1949-2063
Classification Level Classification E-value
Superfamily PH domain-like 8.49e-32
Family Pleckstrin-homology domain (PH domain) 0.0000107
Further Details:      
 
Domain Number 4 Region: 672-826
Classification Level Classification E-value
Superfamily Spectrin repeat 3.42e-29
Family Spectrin repeat 0.00086
Further Details:      
 
Domain Number 5 Region: 1410-1565
Classification Level Classification E-value
Superfamily Spectrin repeat 9.17e-29
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 781-934
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-27
Family Spectrin repeat 0.0000334
Further Details:      
 
Domain Number 7 Region: 1623-1776
Classification Level Classification E-value
Superfamily Spectrin repeat 6.55e-24
Family Spectrin repeat 0.0022
Further Details:      
 
Domain Number 8 Region: 991-1144
Classification Level Classification E-value
Superfamily Spectrin repeat 1.78e-23
Family Spectrin repeat 0.00071
Further Details:      
 
Domain Number 9 Region: 439-542
Classification Level Classification E-value
Superfamily Spectrin repeat 4.8e-22
Family Spectrin repeat 0.00036
Further Details:      
 
Domain Number 10 Region: 1254-1353
Classification Level Classification E-value
Superfamily Spectrin repeat 2.76e-21
Family Spectrin repeat 0.00025
Further Details:      
 
Domain Number 11 Region: 581-691
Classification Level Classification E-value
Superfamily Spectrin repeat 8.37e-19
Family Spectrin repeat 0.005
Further Details:      
 
Domain Number 12 Region: 1152-1250
Classification Level Classification E-value
Superfamily Spectrin repeat 1.05e-16
Family Spectrin repeat 0.00065
Further Details:      
 
Domain Number 13 Region: 1781-1841
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000245
Family Spectrin repeat 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009223   Gene: ENSTNIG00000006455   Transcript: ENSTNIT00000009394
Sequence length 2103
Comment pep:novel chromosome:TETRAODON8:Un_random:37592060:37604744:1 gene:ENSTNIG00000006455 transcript:ENSTNIT00000009394 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADASLRHTPTVTMTTVAAELDHMELQQQYSSLDTVNNRWDDDWDNENSSARLFERSRIKA
LAADEREAVQKKTFTKWVNPHLSRVSCRISDLYMDLRDGRMLIKLLEVLSGERLPKPTKG
RMRIHCLENVDKALQFLKEQRVHLENMGSHDIVDGNHRLTLGLIWTIILRFQIQDISVET
EDNKEKRSAKDALLLWCQMKTAGYPNVNIHNFTTSWRDGMAFNALIHKHRPDLVDFDKLK
KSNAHYNLQNAFNLAEQHLGLTKLLDPEDISVDHPDEKSVITYVVTYYHYFSKMKALKVE
GKRIGKVLDHAIEAEKMIQKYEHLASELLEWIEQTIIILNNRKFANSLLGVQQQLQAFNT
YRTVEKPPKFTEKGNLEVLLFTIQSKMRANNQKVYLPREGKLISDINKAWERLEKAEHER
ELALRTELIRQEKLEQLARRFDRKAAMREAWLSENQRLVSQDNFGLDLQAVEAATKKHEA
IETDIAAYEERVQAVVAVARELEAERYHDIKRVAARKENVLRLWEYLLELLKARRRRLEK
NLGLQRLFQEMLHIMDWMDEMKVLGGSGSGXALHEQAAALPAQEAPHVHARLAGIEERYR
EVAELTKLRKQALQDALALYRMLSEADACQRWIAEKEQWLHGTRIPEKLEDLEVVQHRFE
SLEPEMNHQASRVAVVNQIGRQLVHSGHPGEKDIRTQQDKLNNRWSQFRDLLDQKKESLN
SALGVQNYHLDCNETKSWITEKTKVIESTQDLGNDLTGVMALQRKLSGMERDLAAIEAKL
GGLGGEARQLAEEHPEQAEAITGRLLEISAVWEEMKTTLKNREESLGEARKLQQFLRELD
DFQSWLSRTQTAIASEDVANTLAEAEKLMGQHQGLKNEIQNYEDDYQKMRDMGEMVTRGQ
TDAQYMFLRQRLQALHTGWNELHRMWENRQKVLSQCHAYQLFLRDTKQAEAFLNSQEYVL
AHTEMATTLEGAEAAIKKQEDFMTTMDANEEKISGVVEAGRRLSSDGNINAERIQERVAS
LDGRQRKNREAAVELLMRLKDNRDLQKFLQDCQELTLWINEKMLSAQDLSYDEARNLHSK
WLKHQAFMAELQSNKEWLQKIQKDGALLVAEKPEMEAVVTQKLLLLQTMWAELESTTQTK
AQCLFDANKAELFTQSCADLDKWMLGLEGQIQSDDCGKDLTSVSILLKKQQMLENQVEVR
QREVVELQSQVQALSQEVKDTDEVDGRRQLLEKKFQELLEPLQQRRNLLLASREVHQFNR
DVEDEILWVEERMALATSTEHGSNLQTVQLLIKKNQTLQKEVQGHQPRIDDILERSQGLL
QDQAIQQRLRDLQQLWSRLRQEAELRHARLQEAHHAQQYYFDAAEAEAWMSEQELYMMSE
EKAKDEQSAVAMQKKHQILEQAVEDYAETVHQLSKTSRGLVAEGHPERGSERISMRQSQV
DKLYASLKDLSEERRGKLDERLRLFQLNREVDDLEQWIAEREVVAGSHELGQDYEHVTML
QERFREFARDTGTIGQERVDAVNRLADELINGGHGDAATVAEWKDGLNEAWADLLELIDT
RTQILAASFELHKFYQDAKEILGRVVDKQKKLPEEDGRDHHTVETLQRTHTAFEHDIQAL
GTQVRQLQEDAARLQSAYAGDKAEDIQRREGEVLEAWGALLQACERRRLRLLDTGDKFRF
FSLVRDLMLWMEDVIRLIQAQEVPRDVSSVELLMNNHQGIAEIDARNDSFTCCIELGKTL
LARKHYASAEIKDRLLQLTDKRKEMIDKWEDRWEWLRLILEVHQFSRDAGVAEAWLLGEP
YLSSREVGRSVDQVEKLLKRHEAFEKSAATWEERFSALERLTTLELLEAAPAEAPSRSRR
RSRSSTSVWESLEMMAVCVLGSGPAPQNGLPADQDSARVSTGTPPVLWTAWRLQPCPTAP
PRSPVPATSPGADRKGTSQASTLPSKNPELATPPQLEGPLHRKHEWEGHNKKASNRSWHN
VYCVINNGEMSFYKDGKAAAQGVAYHQQGPASLKDAACDVASDYKKKKHVFKLRLADGNE
YLFQAKDEEEMSSWIQAVLTAASGGHGSPPSTPPPGRAQTMPAAVSLASESSPGRFSLFS
KKK
Download sequence
Identical sequences H3CLU4
ENSTNIP00000009223 ENSTNIP00000009223 99883.ENSTNIP00000009223

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]