SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009293 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSTNIP00000009293
Domain Number - Region: 263-370
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0131
Family Spectrin repeat 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009293   Gene: ENSTNIG00000006522   Transcript: ENSTNIT00000009464
Sequence length 398
Comment pep:novel chromosome:TETRAODON8:15:569193:571321:1 gene:ENSTNIG00000006522 transcript:ENSTNIT00000009464 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RADGEDRGPGADYCVFAAMEGLLEKLKLLDYEEEVLAKHNIVKNLSRHYFVSSSHVTSNP
GEQFYVFTITAAWLLGLAGRPVPEPLESDEPGASLAAILAELRALGVKVDFPPSKLKSGS
GEQVCFVLDRLADQALRRTGFSFRRPKYPTETTEEESILEDDAELALSRVEEEEPTEPDD
DEDVLDLDALRLQTTECESRPRADEGPEPPVDAAEWNLEVERVLTQLKAAPRTDKQQWRS
HLDQMHQHNDAIRSLTEDSNSYLSRLQQDLSQALEKVSSRERYIGQQLEPLIQEYRSVRA
RLHQEQERYQQANARVMEKRQELREISDEVKKMEQEIKDRDTSMSDGAAPVVRIRRTTRL
KQELVQMDVRIGVVQHSLLLSRLKEKSNMTLDLHATNI
Download sequence
Identical sequences H3CM13
99883.ENSTNIP00000009293 ENSTNIP00000009293 ENSTNIP00000009293

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]