SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009331 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009331
Domain Number 1 Region: 332-521
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 1.7e-48
Family CRAL/TRIO domain 0.0000297
Further Details:      
 
Domain Number 2 Region: 247-327
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 2.62e-21
Family CRAL/TRIO N-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 534-699
Classification Level Classification E-value
Superfamily Supernatant protein factor (SPF), C-terminal domain 5.1e-20
Family Supernatant protein factor (SPF), C-terminal domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009331   Gene: ENSTNIG00000006557   Transcript: ENSTNIT00000009502
Sequence length 726
Comment pep:novel chromosome:TETRAODON8:Un_random:14489350:14496954:-1 gene:ENSTNIG00000006557 transcript:ENSTNIT00000009502 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VAMVQKYQSPVRVYKQPFELVMAAYERRFPTCHLIPMFVASDVISQETSEDGSSHRIQRR
CALDVDAPRLLKRIAGVDYVYFIQKNSLDRRERTLHIESHNETFSNRVIIHETCCYSVHP
ENEDWTCFEQSASLDIKSFFGFESTVEKIAMKQYASSIKKGKEIIEFYLKQLEDEGIHHV
PRWAPSSLPGAAPRPSSLSVSPPLLPTPASTPSASASQPGEGKDAAAQDSGVAPADGLAD
ILAAAPEDKLDADYIKRYLGDLTPLQESCLIRLRKWLQESHKGKIPKDEHILRFLRARDF
NMDKAREILCQSLTWRKQHQVDYLLDTWSSPQVLQDYYTGGWHHHDRDGRPLYILRLGHM
DTKGLVRALGEESLLRHVLSINEEGLRRCEENTKVFGRPISCWTCLVDLEGLNMRHLWRP
GVKALLRIIEVVEANYPETLGRLLILRAPRVFPVLWTLVSPFIDENTRKKFLIYAGNDYQ
GPGGLVDYIDKEVIPDFLGGECMCEVPEGGLVPKSMYRTPEELENEDVRLWTETIYQSAS
VFKGAPHEVLIQIIDAASVITWDFDICKGDVVFNIYHSKRAPQLPRKDPLGAHGISSPGV
NNVQLIDKSWTLGQDYSMVESPLTCKEGESVQGSHITRWPGFYILQWRFHNTPACAATNL
PRVDDVLATLQVSSHKCKVMYYTELLGSEDFRGSMTSLESSHSGFSQLSAATTSSSQSQS
SSMISR
Download sequence
Identical sequences H3CM51
99883.ENSTNIP00000009331 ENSTNIP00000009331 ENSTNIP00000009331

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]