SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009455 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009455
Domain Number 1 Region: 12-244
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 1.74e-84
Family Calponin-homology domain, CH-domain 0.0000231
Further Details:      
 
Domain Number 2 Region: 264-386
Classification Level Classification E-value
Superfamily Spectrin repeat 1.53e-34
Family Spectrin repeat 0.000000618
Further Details:      
 
Domain Number 3 Region: 500-621
Classification Level Classification E-value
Superfamily Spectrin repeat 8.24e-32
Family Spectrin repeat 0.00000316
Further Details:      
 
Domain Number 4 Region: 387-495
Classification Level Classification E-value
Superfamily Spectrin repeat 3.14e-25
Family Spectrin repeat 0.00000371
Further Details:      
 
Domain Number 5 Region: 624-736
Classification Level Classification E-value
Superfamily Spectrin repeat 1.58e-23
Family Spectrin repeat 0.00000238
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009455   Gene: ENSTNIG00000006676   Transcript: ENSTNIT00000009628
Sequence length 760
Comment pep:novel chromosome:TETRAODON8:Un_random:87666612:87679316:-1 gene:ENSTNIG00000006676 transcript:ENSTNIT00000009628 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEQYDGDGDYMQQEDDWDRDLLLDPAWEKQQRKTFTAWCNSHLRKAGTQIENIEEDFRDG
LKLMLLLEVISGERLAKPERGKMRVHKISNVNKALDFIASKGVKLVSIGAEEIVDGNAKM
TLGMIWTIIRFAIQDISVAETSAKEGLLLWCQRKTAPYKNVNIQNFHISWKDGLGFCALI
HRHRPELIDYGKLRKDDPMTNLNTAFDVAEKYLDIPKMLDAEDIVGTARPDEKAIMTYVS
SFYHAFSGAQKAETAANRICKVLAVNQENEQLMEDYEKLASDLLEWIRRTVPWLENRMPE
NTMQAMQQKLEDFRDYRRLHKPPKVQEKCQLEINFNTLQTKLRLSNRPAFMPSEGKMVSD
INKAWGNLEGAEKGYEEWLLNEIRRLERLDHLAEKFRQKAAIHEAWTEGKEDLLQNRDYE
TASLSEIKALLKKHEAFESDLAAHQDRVEQIAAIAQELNELDYYDSPSVNARCQRICDQW
DALGALTQKRNEALQRTEKLLETIDQLYLEFAKRAAPFNNWMEGAMEDLQDTFIVHTIEE
IQGLSTAHEQFKSTLPDADKERQAILGIHNEIAKIVQTYHVNMAGSNPYTTINPQEINTK
WDKVRQLVPQRDQALIEEHARQQNNERLRRQFANQANVIGPWIQTKMEEIGRISIEMHGT
LEDQLHHLRQYEKSIVNYKPKIDQLEGDHQLIQEALIFDNKHTNYTMEHIRVGWEQLLTT
IARTINEIENQILTRDAKGISQEQLNEFRASFNHFDRVST
Download sequence
Identical sequences H3CMH4
ENSTNIP00000009455 ENSTNIP00000009455 99883.ENSTNIP00000009455

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]