SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009594 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009594
Domain Number 1 Region: 2118-2388
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.83e-24
Family G proteins 0.058
Further Details:      
 
Domain Number 2 Region: 1531-1745
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 7.56e-24
Family Extended AAA-ATPase domain 0.017
Further Details:      
 
Domain Number 3 Region: 2451-2567,2599-2721
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.1e-20
Family Extended AAA-ATPase domain 0.049
Further Details:      
 
Domain Number 4 Region: 1761-1966
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.000000000108
Family Nucleotide and nucleoside kinases 0.093
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009594
Domain Number - Region: 1084-1181
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0013
Family Spectrin repeat 0.0097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009594   Gene: ENSTNIG00000011098   Transcript: ENSTNIT00000009769
Sequence length 4142
Comment pep:novel chromosome:TETRAODON8:15:4376558:4400590:-1 gene:ENSTNIG00000011098 transcript:ENSTNIT00000009769 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DERVDFLREQAFCVLRVKTDKWNRFIGTEENQKMILDFLDHIWTDKLLLYTGPGGTLHAG
NAQASPQWRSKVLCVLKKGVKRITRDGFRYQLQLGEVPCFPMEHLPVVISEVLLHVLSNG
LNHQDWPQVTLDDIQNHLERLRTRVVTLKGQAEGRTLLPLPLCLERAQTQEIVLSPIGWP
LDQALFSSIETLTVQWSLQICDVLRKDSGALLLRGDHPGPAEEIQFWSAQRENLLGIQSQ
LRSPKVECIMEILRQVKSSYYPSFKDVCLEVDEAVLEAEDIDLYLRPLRRVISNLEETTF
PKVADVLPALFHTLCLIWSHSRYYCTAQRMVVLLQEFCNLIIEKAFAYLIPEELFKMELE
EGVERVQITITVLQTFKQLFYAHRQRIPQYFRDTAAIRLWDFPARLVFQRSDCIMERLRM
IEELFATALDFLKLEKVELGGSRGKVLSQMVLGISEEFHDHWRAIRESKYDSLDYTNDDF
VCHYMHFMEQSRDFDQRLATVLNQAFQDSKNLNSTFKLLNIFSTLLERPRIHQQFAPNYN
VLLAMFSQEIDHCQVIFNHHRVALQSGCATLGKNMPSVAGNLKWSQQLRSRILSNRSNLC
QLAHVPLGCAEVDDVLQKCEHVLESLDQLDEQLFSEWTVGLEETCQSHLKEPLLTLDTDT
GCFHVNFSPVLTSVLREVKYLDMLKTPNIPKAAVQLHSQQERLYVYTQTLTLVTQWYNQL
HSTLLDVELELVKDEMDAMRRQLEPALQELVWSQDDLMDYIQSTRDLMKGISSRVQKSKA
NVETIQALMAKFSQRPFITRRSNDSVFQILSDIEESVTKQHTLVRSAGEQIHNLLQENQS
LLGVSDLDSSEWKAYTDYVDNIVLTGFCSAIRCSLQYLLDYTDAAQRCAPLFEVQLLLSG
NEMTFDPPLDLSYRGNFYEIVDKMVASITHMASFIPRLAKHKQLDNYQSNINEMEDLAEM
CHTIRSRARMAVAKIREYQASFSSYRYLWTDDRSEFMRQFLLYGHVLSTEEAELYAEYEL
KKNPPTLDNFKEQINLFETLYLRVSKMEDQRVFCGWLQLDIKPFKHTLMNVIKKWSWMFK
EHLLNHVNESVRELSSFLLDTTLGLSDKVVDGDYAGLVTIMGHLMAIRDRQISNEKHFKP
LKSTAELLKTYGQQLPESIHTQLEELPEKWKSLKKIAFTVKHEVAPLQSNEVSVIRRKCA
WFEVKQHEFRERFRTEPIFRINVEEPYKLLDESNQAVAVMETDMKKLQDTADLFEVSFPE
YKQLRQCRSDITLVKAVWDMVIFVKSSIEDWTKTPWKEINVEQMDMELRRFAKLFIVREM
KMLEKEVRVWDVYAGLESIVKNLLTSLRAVNELQNSAVRERHWQQLMNTTGVRGRFGSCL
SVSESVKKNQESYSTVYVMLYTPFYLLLCNLMYFHLTDLPSHVQACNNRSKSVNPITQLN
SLIHMLLGDLSPGDRQKIMTICTIDVHARDVVANLISQKVASAQAFAWLSQLRHCWDDET
GHCYVNICDAQFQFSYEYLGNTNRLVITPLTDRCYITLTQSLHLTMSGAPSGPAGTGKTE
TTKDLGRSLGIMVYVFNCSEQMDYKSIGNIYKGLAQTGVWGCFDEFNRISVEVLSVVAVQ
VKTIQDAIRNKKRRFHFLGEEIDLKPTVGIFITLNPGYAGRAELPENLKALFRPCAMVIP
DFELICEIMLVAEGFIDARLLARKFICLYTLCKELLSKQDHYDWGLRAIKSVLVVAGSLK
REDRSRPEAQVLMRALRDFNLPKIVTSDVPIFLGVLNILFGIQSNHIYVTHNPVFSCLQV
SQLEELLAVRHSVFVVGGPGTGKSQILKTLHRTYANMKLKPVWTDINPKAVTTDELFGYL
HPATREWKDDNVACCFIVGLFSSTMRELTSLSHDGPKWIVLDGDIDPMWIESLNTVMDDN
KVLTLASNERISLSSSMRLLFEISHLKAATPATVSRAGILYVNPQDLGWSSYVASWIDTR
QAQSERANLTILFDKYVPYCLEQVRCNLKTITPIPENSMVQTLCSLLECLLTDHNTPADS
PRELYEIYFVFACVWAFGGALFQDHVCNAQVLQVIKLQTAIFLFYSLLQLNDYRAEFSRX
EELQKQTALVHTPETICLTYFIDLLLQRGKPIMLVGNAGVGKTILVSDKVSKLKEDYMVA
KVPFNYYTTSAMLQRVLEKPLEKKAGRKFAPPTAKRLIYFIDDLNMPEVDVYGTVQPHTL
IRQHLDYSHWYDRQRLVLKEIHNCQYITCMNPTAGSFSINPRLQRHFSVFSVHFPSADAL
ATIFSSILSAHFLQGGFSYGVSRSVGTLIQAAICLHQKVSQNFFPTAIRFHYIFNLRDLT
NIFQGILFALPETVRYPTDLVHLWLHESSRVYSDKLMEEKDVELFNKILLDTGKRYFEGV
DESMFIHQPLVYCHFAQGVGEPRYHQVSDWEKLQKTLADALEHYNELHAVMDLVLFEEAI
QHVCRISRILEAPYGNALLVGVGGSGKQSLCRLAAFLSTLEVFQVTLRKGYSINDLKSDI
AALYIKVGLKNIGTVFLHTDAQIPDERFLVLINDMLASGDIPDLFSDEDMDMIVNSIRME
LRGLGLIDTRDNCWSFFIERIRRQLKVVLCFSPVGFTLRTRARKFPALVNCTAIDWFHPW
PQHALQSVSTTFIEKIPGLEPKVRMSISDFISFAHTSVNEVSVKYQQNEKHFNYTTPKSF
LEFMKLYGNLLRKKHTELAQKMERLENGLQKLLTTASQVEDLKAKLALQEVELWQKNADI
EALIAKIGQQTEKLNQERAVADAEEQKVAAIQTEVTKQQRETEEDLAKAEPALQAADAAL
NTLNRLNLTELRTFPNPPAIVTNVSAAVLVLLSPQGRIPKDRSWKASKMVMSKVDDFLQA
LVNFDKERIPEATVKSVKEEYLSDPEFNPEFVRQKSSAAAGLCAWVINIIRFHEVLCEVE
MKRMCLSQANADLAEAAEKLEAIRKKLAELDGSLEMLTTAFEKATSEKLRFQEEVNRTNT
TIELANRLVKGLESENVRWAHSLAQFHEQEDTLSGDVLLTAAFISYAGSFSKKYRRELLE
NLWMPFLRTQLPIPMTEGLDPVSMLTDDATVAQWNNEGLPGDKMSTQNATILTNCERWPL
LIDPQLQGIKWIKNRYGSGLKVVSLGQKGYVDVIEQAVVSGDTVLIENLEETIDPVLDPL
LGRHTIKKGSCIKVGDKECVFHPGFRLILHTKLASPHYKPEIQAQTTLINFTVTRDGLED
QLLAQVVNQERPDLERLKSELTKQQNMFKIELKLLEDELLTRLSAAESNFLGDNLLVEKL
ETTKHTAAEIEMKVLEAKVNEVKINEAREHYRPVAVRASLLYFIMNDLNKINPMYQFSLK
AFNVVFHKAVEMAEASDDVTGRVNILIDCVTFSTFNFISRGLFERDKLTFTAQLAFQLLL
MSKEIDVRELDFLLRFNIDHSYNSPVEFLSNSAWSAIKVMSFTDDFRGLDRDIEGSPKRW
KKLVESECPEKEKFPQEWKGKSSLQKLILMRALRPDRMTYALRNFVEEKLGTKYTEGRKT
EFAKSYRESGPATPVFFILSPGVDPLKDVESLGRKLGFTIDLGKLHNVSLGQGQEAVAEV
AVEKAAKEGHWVILQNIHLVGRWLGSLEKLLERCCEDSHPDYRVFMSAEPAPTAQEHIIP
QGILENAIKITNEPPTGMHANLHAALDNFDQDILDQCSREQEFKTILFSLCYFHACVAER
RKFGPQGWNRKYPFNTGDLTISVNILYNYLEANAQVPWEDLRYLFGEIMYGGHVTDDWDR
RLCRTYLEEYMQPNQFDQKLALAPGFVVPSNLDYKGFHKFIDEMLPHESPVHYGLHPNAE
IEFLTVTSDNLFHTLLELQSPDAVMGEGASQTLEEKVKTILDEVLEKLPEEYNMSDITSK
TAERSPYTLVCLQECERMNLLVSEMRRSLKELDLGLKGELAISSEMEKLQSALFFDNVPE
TWTKLAYPSTYSLAIWYNDVLQRCKELDTWTQDLSLPSVVWLSGLFNPQSFLTAVMQTLA
RKNEWALDKVNLTVDVTKKFKEEFNQPAREGAYVYGLYMEGARWDTQTGVICEARLKELT
PSMPVISVRAVPNDRQETRNIYECPLYKTKIRGPTYVWTLSLKTRERPAKWVLAGVALLL
SV
Download sequence
Identical sequences H3CMW3
ENSTNIP00000009594 99883.ENSTNIP00000009594 ENSTNIP00000009594

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]