SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000009790 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000009790
Domain Number 1 Region: 2-220
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 2.09e-64
Family Calponin-homology domain, CH-domain 0.00000813
Further Details:      
 
Domain Number 2 Region: 4131-4289
Classification Level Classification E-value
Superfamily Spectrin repeat 4.71e-30
Family Spectrin repeat 0.0027
Further Details:      
 
Domain Number 3 Region: 3258-3418
Classification Level Classification E-value
Superfamily Spectrin repeat 1.06e-28
Family Spectrin repeat 0.002
Further Details:      
 
Domain Number 4 Region: 4570-4727
Classification Level Classification E-value
Superfamily Spectrin repeat 5.04e-27
Family Spectrin repeat 0.0021
Further Details:      
 
Domain Number 5 Region: 3690-3847
Classification Level Classification E-value
Superfamily Spectrin repeat 3.53e-24
Family Spectrin repeat 0.0023
Further Details:      
 
Domain Number 6 Region: 3910-4070
Classification Level Classification E-value
Superfamily Spectrin repeat 8.14e-24
Family Spectrin repeat 0.0044
Further Details:      
 
Domain Number 7 Region: 5072-5148
Classification Level Classification E-value
Superfamily GAS2 domain-like 1.24e-23
Family GAS2 domain 0.00048
Further Details:      
 
Domain Number 8 Region: 236-352
Classification Level Classification E-value
Superfamily Spectrin repeat 3.6e-22
Family Spectrin repeat 0.0061
Further Details:      
 
Domain Number 9 Region: 4368-4503
Classification Level Classification E-value
Superfamily Spectrin repeat 5.32e-21
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 10 Region: 4789-4964
Classification Level Classification E-value
Superfamily Spectrin repeat 1.11e-20
Family Spectrin repeat 0.0054
Further Details:      
 
Domain Number 11 Region: 2365-2491
Classification Level Classification E-value
Superfamily Spectrin repeat 3.1e-19
Family Spectrin repeat 0.0028
Further Details:      
 
Domain Number 12 Region: 3581-3739
Classification Level Classification E-value
Superfamily Spectrin repeat 5.11e-19
Family Spectrin repeat 0.0048
Further Details:      
 
Domain Number 13 Region: 1151-1283,1310-1336
Classification Level Classification E-value
Superfamily Spectrin repeat 7.76e-18
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 14 Region: 2703-2861
Classification Level Classification E-value
Superfamily Spectrin repeat 1.44e-17
Family Spectrin repeat 0.0058
Further Details:      
 
Domain Number 15 Region: 570-715
Classification Level Classification E-value
Superfamily Spectrin repeat 2.2e-16
Family Spectrin repeat 0.0041
Further Details:      
 
Domain Number 16 Region: 4298-4404
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000175
Family Spectrin repeat 0.0024
Further Details:      
 
Domain Number 17 Region: 3179-3269
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000000946
Family Spectrin repeat 0.008
Further Details:      
 
Domain Number 18 Region: 3386-3514
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000196
Family Spectrin repeat 0.0052
Further Details:      
 
Domain Number 19 Region: 4989-5063
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000000226
Family Polcalcin 0.064
Further Details:      
 
Domain Number 20 Region: 1820-1936
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000000000327
Family Spectrin repeat 0.006
Further Details:      
 
Domain Number 21 Region: 2919-3084
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000000985
Family Spectrin repeat 0.014
Further Details:      
 
Domain Number 22 Region: 4501-4583
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000000000249
Family Spectrin repeat 0.0075
Further Details:      
 
Domain Number 23 Region: 2274-2383
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000245
Family Spectrin repeat 0.0093
Further Details:      
 
Domain Number 24 Region: 1704-1809
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000475
Family Spectrin repeat 0.0056
Further Details:      
 
Domain Number 25 Region: 2498-2633
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000694
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 26 Region: 1919-2042
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000993
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number 27 Region: 3082-3201
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000000419
Family Spectrin repeat 0.0082
Further Details:      
 
Domain Number 28 Region: 695-796
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000108
Family Spectrin repeat 0.01
Further Details:      
 
Domain Number 29 Region: 1468-1571
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00000103
Family Spectrin repeat 0.0076
Further Details:      
 
Domain Number 30 Region: 1359-1458
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000072
Family Spectrin repeat 0.015
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000009790
Domain Number - Region: 1055-1155
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000259
Family Spectrin repeat 0.0037
Further Details:      
 
Domain Number - Region: 523-563
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0108
Family Spectrin repeat 0.0053
Further Details:      
 
Domain Number - Region: 2049-2142
Classification Level Classification E-value
Superfamily Spectrin repeat 0.011
Family Spectrin repeat 0.011
Further Details:      
 
Domain Number - Region: 978-1088
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0272
Family Spectrin repeat 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000009790   Gene: ENSTNIG00000006990   Transcript: ENSTNIT00000009967
Sequence length 5333
Comment pep:novel chromosome:TETRAODON8:Un_random:12634208:12716068:-1 gene:ENSTNIG00000006990 transcript:ENSTNIT00000009967 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SDERDRVQKKTFTKWVNKHLIKVQDHANILHTNKVESVQFIYMIIPMLAKLPREKGRMRF
HRLQNVQIALDFLKQRQAKLVNIRNDDITDGNPKLTGLIWTIILHFQISEIYVSGESSDL
TAKEKLLIWSQQATEGYPGLRCANFTSCWSDGRMFNALLHRYRPDLIDMEMVSQQSNQEN
LEQAFEIAESLGVTRLLDAEDVDVPSPDEKSVITYVSSIYDAFPKIPEGGEGIAVNDVDK
HWSQYQSRFSSLLQWSHQHTALMANKTFPQNPAELKALYNEYVHFKETEIPAKEVEKGHI
EHLYKLLEAWIEFGRIRLPQGFHPNDLEEEWGKLILEMLEREKALRPAVERLELLLQRAN
KVQNMALECEEKLTLAKNTLQADMSRIENGEAVKCERELACYLQDCEALNRQLNQELKVL
RDEKYYQVDQLAFRVSCLQEELVSLRLQCSSIYRKGHFSQSLSSTGAEHTSQRAMDSGLT
LGQTLLGTVGAVGAALLRRPMARSQLVAMSSSEDEGSLRFIYELLGWVEETQELLDQAEW
GADLPTVENNLQEHNTIHTAVKELMSGVQEARTYEAKVSPNFKSSYSDTLAKLEHQYCKL
LEHSSWRLQSLETLHGFVSRCTEELIWLNEREEEEIAFDWSDNNPNLSAKKELYSEMRLE
LDAKQEVMHSLQETAHHLCQENHPAKQTVEAYSAALQTQWQWVNQLCLCVEEHLKDNSAY
FQFSSDVRECEAYLRQLQETIKRQYTCDKNSRLSKLEDLLQDSMEEKEQLIEYRSTVASL
VGRAKTVVQLSPRGAETPLASTTLIKAICDYRQIEITVNRGEECVLQDNSQRTKWKVISP
TGNEAMVPSVCFTVPPPNLEAINAASRVEQLYQKVMSLWHQQHVNMKSVVSWHYLLKDIR
NISGWNLDKVRRQAPAERQELLKHLESHLADFLSDSKESTVFTSGERRQLEEDAEQAQQH
CQNLVLNMETVEKDESVSRAYLSELQNITLQLKEAEQRLMTAIETPPTSRLSADGADVIH
HIQAQKKLQSELDSLCSSVGDLSRRCIHFFGEKPTSPGIPALRSELSYAMEKRDKLHNLS
SVYLEKLKTIDILIHNLDEAESQVRKNESRLSEEDIVPADITAIKSLRDQTQKWQDELGE
HEDIFHTLQSQVDRAKEVGSQLNRLHPDRSPELERYQERASQMAERWSGIKRQIETRRTD
LEALGATLKQYRDGHSDLIRWIEETTQRQENTQPGQTDSKGLSEQLAQQTALVAEIEQNQ
VKLNECHTHSKQYCTLVKDYELQLMTYRALVESTHKSPVKKRRMHSFSDAITQEYMDLRT
RYTALVTFTTQHVKYISDALRRLEEEEKEVEEEKQARVDQVSDLLDWVKGLQQRSRGPNA
ESSLAAQQAITEQLSAKKDEVAEAIRNTQVFLMSKQASILSPEERTHVEAQLDELTAAYN
QLCDSSTQQLQQLEQQLATEEEKKVVQQQKAECSQKLDGLNMWLAETASLLAGQKSSTGS
ADVKVLQERQQKLKAVQHDLQNKREGIAEAIHAVEDLLTEKGDSLSPQERQNLQMTLTRM
KEQYSALTRSLDTSLSDVDTAISTAVQQNMQKAKAEEELQETQGQINLLLNELSSTNQTD
RSVASGMVGDFADAASPPPEDAVALHTETLHVRLLFMLPKRKLHRCVLFLQAELQQLQDQ
QAQLLQITQSTRALLEQPDSTVPPEEKQRLRVALDQLQTQHQDRLQSCQHRLRKSEALKD
ELTKFLQEHKSFVAWLEQSEEELRYLGEGETDAQGLKDKLEDHRKLGEEVICHKADLRFV
SISGQKVLDTAQGALEQAGGSNPALCSTSKMVTDKLHDANHRYTGLHTKSAELGSRLSGL
LERYQQYQDEVVSLHSWLSTQEQNQSTAKPSGETDPQNLQSMLRQVQLLQDELAEHLVQL
EKVKRAGRDLVSTVESPSLKAVDILCAADGLEKRFDSLSASVSERAEQLQTAMAQSVSVQ
EGLRCLLSWLDNLDLKPGPVEATAHAVQDAMTQNQKLRQELLSRQGSVEATRDSVSKLLH
SSDAPMDSDLQSALDELTQRYAAAQACQAEWEVELKALLPRLESYERLGSDLLVFTQSRL
RALSPXYNSSPTLLCPQDLLNDWESQGSRVQELNRTGSELESVIINITAPQNKTGNKKNT
VKNIHSTTVTKQKSEKVNEEQLKKISTVLFKSYDLVHCSCDGCLVWCYTSENVSLIRQPF
HSFITMLLTITASFRFFVFDFCFFFNLTRVCLPGAPQITGSAAPSSVNGIHTCKDLTELQ
VAVSDVNGRYEKLGVELKDRLSHQQTALGLRQKAKQSTEELKNWLTERELSLKQAQTASP
SRPEVLRIQAQEVKVLVSDLAKRSGQVEELKSTLRKLIADSPDSPEVDSWRQQLLEIDSR
WQTANQKAAQRQTELETCVDRLSSFSSMANQLGPWLREKELMMSVLGPLSIDPNMLNTQK
QQVQFMLREFETRRPQFDQLTQSAEGILSQTGNSAEDSKDLVEVQAELGSISQQWEDLTQ
RLGQRSNHIDQAQGTSERFQALLRELSSSISALSERLDAQASLSAQPEALKLRLQETGEI
RSELERRRVELAEAERLCQELSAIVAEPYLKEELSKRLESISNPLKSLEERAADGLFQLQ
TALSSTQQFHQMFEELRSWLEKQTDARESFSDSLPCQAEAIRSLLAQTGEQQRAIASQRG
SYELIQAEGVSLLASLPAGGDERSALQSRLTTLRQDWEELNQRISDRECRLKNILTKADV
YQQHKTELTPWLFECEQKDEEIQPSLNPSALSDALQKARSLSLDLERRQPLVEAFNIGVD
QLLEQCCIGEETKVRDEKAQINRRVDNLSERLHHRTCQLEELSGRLKEFEEGRQAAERRL
EAARHQIEVQEALGPQACSAKSLERLRSQQDNLRSLKPQVVYLRDLAQGLVRDSPQTKEG
SAMGAQRLQRQAEDLEKEYDDVSDKIEGCCCSLESRLQGVSEVQSHVRDVFSRLADLDDE
LDSLSPVGRDADSLASQADALQSFLSRLTNLKTELEGHASECTSMLRREGSSPDLLAVRR
ETEALSRQAGKLSERGQAKLGQVEDAAERVREFYRLVAELQDLLGSAEEGLASQSIVGTE
VEMIKQQLKDFKIFKKKILLRIKLRLKQVVGGSVFVSRSTDNACGVRKLDERVIFDALKL
TXRWNHLQKKIAERIAQLQEALLHCGKFQDALEPLLSWLRDTEDLVANQKPPSAEYRVVK
AQIQEQKLLQRLLDDRRPTVEMIHAEGERIAATADPADREKIETQLHKLAERWADLLDKA
GARQRQLEELQVLALQFHESVEPLGEWLSTTERRLSSAEPMGTQTAKITQQITKHKALEK
EVSSREAEVRHLESLKQLLIPLSCAADCDWLSERVDAVRSGHSDLVAWCERRGILLEQAL
ANAQLFGEDEVEVLNWLAEVAQRLSQVSVQSYQPQSLAKQHQHTLALNEEILGRKKTVDQ
AIKNGQALLKQTTGEEVLLIQEKLDGIKSRYAEMTAGSSKALRILEQALQLATRFASAHE
DLSQWLDSVEAELNSVEPDATPTYQERQKELKKVSAEKRLLDTANEVSNALLDLVPWRAR
EGDRLVADVNQRYRQADDTITQRVRIVQAAIQRSQQEYEEAVDAELAWVAETERKLTSLG
PLSLEPDVTVAQLQVQRAFNIDIIRHKDTVDQLLATRDDILETCSDAQKDALLMKTDSLS
TRYDAVSQRHSERFSALEQAQVLVARFWETYEELEPWLGETETLITQLPPPAIDTDALRL
QQDQMRLLRESIAEHKPHIDKILKIGPQLAELSVQEGETVTQRYTEAEKRYSAIKEGVKA
RAAALDEAVSQSSQVFHPQFHDKMDPLLETLEGAVQRLRQPPSVAAEVEKIREQLAEHRA
QGMELDKLLPSFSALCARGEELIGRAAYDDPAAQAVRSRLLRLRSLWDEIRQRAEEREGK
LNDVLDLAGKFWADMAALLSTLKDSQDICELEDPGVDPSLIKQQIEAAEAIKAETDGLRE
ELEFVRTLGADLIFACGETEKPEVKKTIDEMNGAWEGLNRTWRERMERLEEAMTASVQYQ
DALQTMFDYLDNAVIKLCEMSAVGTDLGTVKQQIEELKQYKVEVYQQQIDMEKLCHQGEL
LLKKVSDQTDRDMIQEPLTELRHLWDNLGDKINHRQHKLEAALLALGQFQHALSELQAWL
NHTHTTLDTQRPVSSDPKAIEIELAKHHVLRNDVLSHHATVENVNGAGAELLESSPGDEA
SHLRDQLDQLNQSWQSLLLKTQERQKQLEAALQQAEGFHGELEEFLQWLRRTESQLSAAK
PTGGLPETAREQLQQHMELQDQLAQRADQYHRLLDQGESMLLARGGDESGPGTTQTQQNL
SILQNKWASLNAKMDDRRAKLDEAVALATGFQTSLQDTINWLTQAEQTLNMAQPPSLLLD
TVLFQIDEHKVFVNEVNTHREQVLALEKAGSQLRFSSLKQDVVLIKNLLLSVQARWDKLQ
RSLDRGRHLDEARKRAKQFHEAWRKLTDWLEEAEKRLDSELEISNEPDKIKVQLAKHKEF
QKALGSKQPVYDTTVRSGKAMRDKAQLPADTQKLDHLVGEVRDKWDTVCGKSVERQHKLE
EALLFSGQFAEALQALVDWLYRVEPQLAEDQPVHGDLDLVSNLMDLHKSFQKELGKRTSS
VQTLKRSARELMDTGRDDTAWVKVQLQELSNRWDTVCALSVTKQTRLQQALKQAEEFRTA
VQVLLECLSEAEQTLRFRGVLPEEAETLQALLHTHRDFMGTVEAKRTDVNKAAGMGEAIL
AVCHPDSITTIKHWITIIRARFEEVLTWAKQHEQRLETALTEVLNNANLLEELLSWLQWA
ETTLIQRDTEPLPQDIPELKTLVTEHQTFMEEMTRKQPDVDKVTKTYKRKPAEASSSLAE
RRGARESPFSAAMQVSGGNPRLNQLCGRWQQVWLLALDRQRKLNDALDRLEELKEFANFD
FDVWRKKYMRWMNHKKSRMDFFRRIDKDQDGKITRQEFIDGILASKFPTSKLEMTAVADI
FDRDADGYIDYYEFVAALHPNKDAYRPTTDADKIEDEVTRQVAQCKCAKRFQVEQIGENK
YRFGDSQQLRLVRILRSTVMVRVGGGWMALDEFLVKNDPCRARGRTNLELREKFILPEGG
PQGLTTFRSRGRRSKPGSRNASPTRSSSSASHSGASLPSAPSAPTTPTASASSRGAASGS
KLKRPPLHSSRGSLTGENGGTTPTSKSSRTARNLPDPKRGGSTVTSRAGSQAGSRASSRR
GSDASDASELQDSRSVCSDTSDTPRRPGSGAKPSKIPTISKKAPSPKTPAAPR
Download sequence
Identical sequences H3CNF9
99883.ENSTNIP00000009790 ENSTNIP00000009790 ENSTNIP00000009790

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]