SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000010366 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000010366
Domain Number 1 Region: 162-267
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 6.67e-16
Family CRAL/TRIO domain 0.0082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000010366   Gene: ENSTNIG00000007556   Transcript: ENSTNIT00000010547
Sequence length 288
Comment pep:novel chromosome:TETRAODON8:4:6997199:6999731:1 gene:ENSTNIG00000007556 transcript:ENSTNIT00000010547 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ADWPDLDTKMNPEGGDIRPAPPTSLPLQGGPGQRKKLSAPRISLSLDQSEDDLGETPDDL
DIDVDELDTPDEGDYLDYTDHETDWEDDPIAPYSAEEERRDVRLWRTVIIGEQEHRINMK
IIEPYMRVISHGGYYGNEVNAIIVFAACFLPDSDREDYHEIMENLFLYVISTLELMVAED
YMIVYLNGATPHRRMPGLGWLKKCYQMIDRRLRKNLKSFIILHPSWFIRTVLAITKPFIS
LSAKFSSKIKYVSSLDELEKLIPMESIQIPECIIRLDKELKDASESSK
Download sequence
Identical sequences H3CQ32
99883.ENSTNIP00000010366 ENSTNIP00000010366 ENSTNIP00000010366

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]