SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011122 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011122
Domain Number 1 Region: 58-183
Classification Level Classification E-value
Superfamily Spectrin repeat 0.000000000144
Family Spectrin repeat 0.0087
Further Details:      
 
Domain Number 2 Region: 500-601
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0000126
Family Spectrin repeat 0.028
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000011122
Domain Number - Region: 185-258
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00223
Family Spectrin repeat 0.015
Further Details:      
 
Domain Number - Region: 812-877
Classification Level Classification E-value
Superfamily Spectrin repeat 0.00496
Family Spectrin repeat 0.013
Further Details:      
 
Domain Number - Region: 621-750
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0374
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011122   Gene: ENSTNIG00000008292   Transcript: ENSTNIT00000011304
Sequence length 988
Comment pep:novel chromosome:TETRAODON8:10:702768:718356:1 gene:ENSTNIG00000008292 transcript:ENSTNIT00000011304 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTQQEFTESLEEALSWIRGVQERLKATDNTHGPRHALEARLRETEKISHSEHEGHLKMDM
ALVTAENLLQSADEKLKNQTQAQLKELKSLWEETCTYITHCHSRIEWVWLHWSEYLKAIE
EFEAWLSKHQRNLDVRIELQLGLKEKLWQVDQQRVALSDIHGQAGLLERLLDEAAALHNR
TQDPSVEAQAQERLQEAYNDVRDRAEERLALLHRMAEEHQTFQECVKRFQSWLLTETKRL
TTLMERDDSAQDKLRALQDLGSGQQHSRGGEDLTALGEHGRNGAKQYIPAGAEGVVEEAE
ELRLGWQRLRQGLCEAEDGLRSSLDSHSQYVSRCQRLGEDIGRLRTLLQRLDGELEDSRE
AGDHAESDEEERLEQWRKYTAVRNSLAGEESQVELLKSQLKELFRFSEDSRHLSDDVLAV
VREHQSLKCRASRLCSESELSLRSVLQDPLLVYAQWSHQVAQLLETSADATDFSRIAISV
HNIEQLLKDSVQLQERFRLLQSKDELLDSAFGPEQSDSLHQELTAAIRNRELLHSQLLQR
KSRLQGLISRTKDFVEGSKLMVSKMASLRELLVAADGPRPDILAKKSQYDQFKVLCQEPR
DSKIHLVALETLVSSGQSNSSQSQRLHAEWSQLLSAVRGKVHESEEAISEHENLHDALLN
MEKWLMIMRQKLESFCSPSGQWSVEGRRHEAQRALGEFPEKELQLQQMEVQAQRVLEKTS
VDGQVHSLQDLKRVQESWLALYDISLNLHRLLNSSAAAASEVWQREAPAAAGRPPTLEKT
AHEKMKACTQEGGRTASTWQSLPGNIPRLRRAFQAWLSQQSDLLSSLLSNTPTPRSPQEL
AVQQDSLKALRAGLDWGQQQFQLLLQESPAKDAAAVSGGQVEDVGLEELRYRWMLHKSKL
KDVGELISLQTLRDTTKRDPAVTEKVTKKAGLLRRACRLALPLWLLLLALLLLAFLLPLM
DAGSSCSLTNNFARSFNIMLRYHGPPPT
Download sequence
Identical sequences H3CS88
ENSTNIP00000011122 99883.ENSTNIP00000011122 ENSTNIP00000011122

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]