SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000011229 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000011229
Domain Number 1 Region: 176-330
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 3.14e-18
Family CRAL/TRIO domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000011229   Gene: ENSTNIG00000008394   Transcript: ENSTNIT00000011411
Sequence length 346
Comment pep:novel chromosome:TETRAODON8:13:7655413:7658484:1 gene:ENSTNIG00000008394 transcript:ENSTNIT00000011411 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PEVCNPPLFVPSLERQESVATTEARLRMEGVELKEEWQDEDFPRPKRPLPEEEELEDELF
AGTSEAEPGYPGIQGKKAKKKLTAPNISLTLDRSEGSLLSDELDESADLDLDGIDTPSDN
SNEFEWEDDLPKPKSTELLQKGVESVQEYSANEEREESRRWRVFRIGEQEHRVDMKAIEP
YKRVISHGGYYGDGLNAIIVFAVCFMPESNQPNYRYIMDNLFKYVIGTLELLVAENYMIV
YLNGATSRKRMPTLSWLRKCYQQIDRRLRKNLKSLIIVHPSWFIRTLLALTKPFISSKFS
QKIQFVYSLADLAELVPMEYVSIPDCIKQFDNEKNRKSHKRQKESE
Download sequence
Identical sequences H3CSJ5
ENSTNIP00000011229 ENSTNIP00000011229 99883.ENSTNIP00000011229

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]