SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013016 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013016
Domain Number 1 Region: 261-456
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 8.77e-48
Family cAMP-binding domain 0.00034
Further Details:      
 
Domain Number 2 Region: 11-259
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 3.01e-35
Family Voltage-gated potassium channels 0.0068
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013016
Domain Number - Region: 434-499
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0623
Family Spectrin repeat 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013016   Gene: ENSTNIG00000010118   Transcript: ENSTNIT00000013208
Sequence length 515
Comment pep:novel chromosome:TETRAODON8:Un_random:91890718:91893538:1 gene:ENSTNIG00000010118 transcript:ENSTNIT00000013208 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
RKRCTVMVVSPSDDAYYYWLMVVGSAVLYNWTLLVARASEPVSTSLQRRNVLLWLVLDYL
CDGVYILDVVVRLHTGFLEQGLMVKDLKRLRQTYVRTLLCKLDLCSILPTDLLCLTTGLG
YTPLLRFNRLLRLYRLFELFERTETRTGYPNAFRIWKLVLYILVIIHWNACGYYSFSKVL
GLGSDSWVYPNASDPAFGSLRQRYIYCLYWSTLTLTTIGETPPPVRDEEYLFMIFDFLVG
VLIFASIVGNIGAMISNMNATRAAFHNRVDVLKHYMQFRHVSKGLEQRIICWLDYIWTNQ
KTVDEQDVFRSLPTKLRAEIAINVHLDTLKKVWIFQDWEAGLLVELVLKLQLQVFSPGDY
ICRKGDVGKEMYIIKDGKLAVVAEDGVTQLAVLTSGSCFGEISILNISGSKMGNRRTASI
RSLGYSDLFCLSKHNLMDTLQEFPEARAQLEQRGQDILQKEGLLENVNLTAGEDLEEKLE
KLETSLDQLQTHVARLQSEFASSQLQLKQRISVLE
Download sequence
Identical sequences H3CXN1
ENSTNIP00000013016 99883.ENSTNIP00000013016 ENSTNIP00000013016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]