SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSTNIP00000013117 from Tetraodon nigroviridis 69_8

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSTNIP00000013117
Domain Number 1 Region: 614-795
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 2.22e-43
Family DBL homology domain (DH-domain) 0.0000254
Further Details:      
 
Domain Number 2 Region: 804-920
Classification Level Classification E-value
Superfamily PH domain-like 2.43e-37
Family Pleckstrin-homology domain (PH domain) 0.00037
Further Details:      
 
Domain Number 3 Region: 2-150
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 0.00000432
Family CRAL/TRIO domain 0.011
Further Details:      
 
Weak hits

Sequence:  ENSTNIP00000013117
Domain Number - Region: 156-248
Classification Level Classification E-value
Superfamily Spectrin repeat 0.0558
Family Spectrin repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSTNIP00000013117   Gene: ENSTNIG00000010218   Transcript: ENSTNIT00000013309
Sequence length 1024
Comment pep:novel chromosome:TETRAODON8:5:13180961:13187749:1 gene:ENSTNIG00000010218 transcript:ENSTNIT00000013309 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLRSGAVCLPGSRDRGGRALLTVCARSSVWSRPDRHHADLCRLLLYYRSILREDVQASGL
TVLIDARGTAPPSVLFSALRSLQQENTPGSVYCVLLLVDKDSSLHVDQPAGPQVEVLRSL
KSLHTHVGLQQVPAQLGGSLTFSQNSWLCFRLRVEQLSCQCENVIRLLQETMAVLQATPL
PAEAQDAELLLSRSKQAMHSVLEDSRLVQLQKEGGASLSWLRLHSAVEEEREAVEKVSAL
YNQVDELLHSLVTLSNRRSQELSFIQDFSRLERAFGEQTGEVQLQAFEEHEDSLELLIKK
QLNFKEFYTHGTCHSGCRTTSAGFTTSGHACRTSLSGSGPLVETSTDQVSCSDRRQGGGE
QGVCVLVGAQPKHRCTRMRPSGLKGSHSQQHLWAGLLQAASHLCDPPAPPAPTSACLCCC
GDPPSWDRPSAIHPVNWAWRYSPQTWCGGGRCSPQLLQPSPGCGTLPGPSVGKLNECLTG
RWRQRSGLSAQPAGGAPSSKEETAEACSSLSSLPHLNSCSSSRRQLLRKTQSLDSPSPPE
GVARRPCPRTVSGPVHRGHTGVLIRGLEVSSTEVTERTLSPRLSTAHGCSGGGPRSSGGP
SSSPAAPQHRAWARSKLRHIVEEMVTTEREYVRSLHYIIHHYFPEMERADLPQDLRGKRS
VVFGNLEKLLDFHSQYFLKELEACWKHPLRAPHCFLRHQQEQFGLYALYSKNKPKSDALL
ASHGTEFFRGKQMELGDKMDLSSYLLKPVQRMSKYALLLTDLMKEVSSSQEAELSTLQAA
TSMVKFQLRHGNDLLAMDAIRECDVNLKEQGQLIRQDEFTVWTGRRRCQRHVFLFQELVL
FSKPKKMEGALAVFIYKHSFKTADVGLTETAGNNGLQFEIWFRRRRSKSNTVILQAPTEE
VKNAWTADITRILWAQATRNKELRLKELVSMGVGNKPFLDIQPSEAAISDRAVHCIMKSR
GARTRASVAVSAFDHSASFKPGALSSGSAPSPMCSSSLLGPLDLHAYRAGPRPPPLTAPS
SPPW
Download sequence
Identical sequences H3CXY2
99883.ENSTNIP00000013117 ENSTNIP00000013117 ENSTNIP00000013117

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]